Pan troglodytes (chimpanzee): 115945181 Help Entry 115945181         CDS       T01005                                  Symbol H3C13 Name (RefSeq) H3 clustered histone 13   KO K11253   histone H3 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05202   Transcriptional misregulation in cancer ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     115945181 (H3C13)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     115945181 (H3C13)   09163 Immune disease    05322 Systemic lupus erythematosus     115945181 (H3C13)   09165 Substance dependence    05034 Alcoholism     115945181 (H3C13)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     115945181 (H3C13)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     115945181 (H3C13) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115945181 (H3C13) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115945181 (H3C13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  115945181 NCBI-ProteinID:  NP_001361487 Ensembl:  ENSPTRG00000044185 VGNC:  83671 UniProt:  H2R5Q1 LinkDB All DBs Position 1:99409206..99409663 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtactaagcagactgcccgcaagtcgactggcggcaaggccccgagaaagcag ctggccaccaaagcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac cgctaccggcccggcaccgtggctctgcgggagatccggcgctaccagaagtctacggag ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac ctggtggggctgttcgaagacacgaacctgtgcgccatccatgccaagcgcgtgaccatc atgcccaaggacatccagttggcccgccgcatccgcggggagcgggcctaa

DBGET integrated database retrieval system