KEGG   Pan troglodytes (chimpanzee): 129137950
Entry
129137950         CDS       T01005                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7-like
  KO
K03038  26S proteasome regulatory subunit N8
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03050  Proteasome
ptr05010  Alzheimer disease
ptr05012  Parkinson disease
ptr05014  Amyotrophic lateral sclerosis
ptr05016  Huntington disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    129137950
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    129137950
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129137950
   05012 Parkinson disease
    129137950
   05014 Amyotrophic lateral sclerosis
    129137950
   05016 Huntington disease
    129137950
   05017 Spinocerebellar ataxia
    129137950
   05020 Prion disease
    129137950
   05022 Pathways of neurodegeneration - multiple diseases
    129137950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ptr03051]
    129137950
Proteasome [BR:ptr03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     129137950
SSDB
Motif
Pfam: JAB MitMem_reg DUF5581_N
Other DBs
NCBI-GeneID: 129137950
NCBI-ProteinID: XP_054528349
LinkDB
Position
1:complement(93357403..93362955)
AA seq 239 aa
MRLDLVVQKVVVHPQVLLNVVDHFNRISKVGNQKCTLHVLLRSWQMKVLDVSSSFTVPFN
EDDKDNCFLAHDYLKNTYRMFKRVNARERIVEWYHIGPKLHKNDTAFDEIMKRYCRNSVL
VTSDMKPKDLGLPTEAYISVEVYEDGTSALKTFEHVTSETGAEEAKEIGVKHLLQDIKDT
TVGTLSQCITNQVLDLKGLNSKLLGTRSYLEKVATGKLSTNHRFIYQLQVFKLLPVISL
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaggctggacctggtggtgcagaaggtggtggtccacccccaggtactgctcaatgtg
gtggatcatttcaacagaatcagcaaggttggaaaccagaaatgcactcttcatgtgctt
ttgcggtcatggcaaatgaaagtacttgatgtatccagcagttttacagtcccttttaat
gaagatgacaaagataattgttttttagcccacgattatttgaaaaacacatacagaatg
tttaagagggtgaatgccagggaaagaatagttgagtggtaccacataggccctaaacta
cacaagaatgacactgccttcgatgaaatcatgaaaagatactgccgtaactcagtattg
gtcactagtgacatgaagccaaaggacttagggctgcccacagaagcatatatttcagta
gaagtctatgaagatggaacttcagccttgaaaacatttgagcatgtgaccagtgaaact
ggagcagaggaagctaaggaaattggagttaaacacttgttacaagacatcaaagacact
acagtgggcactctttcccagtgtatcacaaaccaggtcctggatttgaagggactgaac
tccaagcttctgggtaccagaagctacctggaaaaagttgccacaggcaaactgtccacc
aaccaccgattcatctatcagctgcaggtcttcaagctgctgccagtcattagcctatag

DBGET integrated database retrieval system