Pan troglodytes (chimpanzee): 453664 Help Entry 453664            CDS       T01005                                  Symbol H2AZ2 Name (RefSeq) histone H2A.V isoform X5   KO K11251   histone H2A Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03082   ATP-dependent chromatin remodeling ptr04217   Necroptosis ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     453664 (H2AZ2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     453664 (H2AZ2)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     453664 (H2AZ2)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     453664 (H2AZ2)   09165 Substance dependence    05034 Alcoholism     453664 (H2AZ2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     453664 (H2AZ2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     453664 (H2AZ2) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     453664 (H2AZ2) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    453664 (H2AZ2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  453664 NCBI-ProteinID:  XP_016800796 Ensembl:  ENSPTRG00000019153 ENSPTRG00000047276 VGNC:  14019 UniProt:  H2QUI9 A0A5S6RB89 LinkDB All DBs Position 6:complement(50693008..50714410) Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaagctggaaaggacagtgggaaggccaaggctaaggcagtatctcgc tcacagagagctgggctacagtttcctgtgggccgcatccacagacacttgaagactcgc accacaagccatggaagggtgggtgccactgctgccgtgtacagtgctgcgattctggag tatctcactgcagaggtgctggagctggcaggtaatgcttctaaggatctcaaagtaaag cgtatcactccgcgtcacttgcagcttgcaatccgtggtgatgaagagttggattctctt atcaaggctaccatagctgggggtggtgtgatccctcacatccacaaatctctgattgga aagaagggacagcagaaaactgcttag

DBGET integrated database retrieval system