Pan troglodytes (chimpanzee): 454593 Help Entry 454593            CDS       T01005                                  Symbol CCL4 Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04064   NF-kappa B signaling pathway ptr04620   Toll-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     454593 (CCL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     454593 (CCL4)    04061 Viral protein interaction with cytokine and cytokine receptor     454593 (CCL4)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     454593 (CCL4)    04623 Cytosolic DNA-sensing pathway     454593 (CCL4)    04062 Chemokine signaling pathway     454593 (CCL4)  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     454593 (CCL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     454593 (CCL4) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    454593 (CCL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  454593 NCBI-ProteinID:  XP_016787457 Ensembl:  ENSPTRG00000030907 UniProt:  A0A6D2Y629 H2RDM0 LinkDB All DBs Position 17:complement(20165002..20167302) Genome browser AA seq 92 aa AA seqDB search MKLCMTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTAKKLPRNFVVDYYETSSLCSQ PAVVFQTKRSKQVCADPSETWVQEYVYDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatgactgtcctgtctctcctcatgctagtagctgccttctgctctcca gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgcg aagaagcttcctcgcaactttgtggtagattactatgagaccagcagcctctgctcccag ccagctgtggtattccaaaccaaaagaagcaagcaagtctgtgctgatcccagtgagacc tgggtccaggagtacgtgtatgacctggaactgaactga

DBGET integrated database retrieval system