Pan troglodytes (chimpanzee): 455232 Help Entry 455232            CDS       T01005                                  Symbol CLDN7 Name (RefSeq) claudin-7   KO K06087   claudin Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03272   Virion - Hepatitis viruses ptr04382   Cornified envelope formation ptr04514   Cell adhesion molecules ptr04530   Tight junction ptr04670   Leukocyte transendothelial migration ptr05160   Hepatitis C Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     455232 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     455232 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     455232 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     455232 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     455232 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     455232 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptr03037]     455232 (CLDN7)    04147 Exosome [BR:ptr04147]     455232 (CLDN7)    04515 Cell adhesion molecules [BR:ptr04515]     455232 (CLDN7) Cilium and associated proteins [BR:ptr03037]  Other cilia and associated proteins   Stereociliary proteins    455232 (CLDN7) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    455232 (CLDN7)   Exosomal proteins of colorectal cancer cells    455232 (CLDN7) Cell adhesion molecules [BR:ptr04515]  Immunoglobulin superfamily   L1 family    455232 (CLDN7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like OppC_N Motif Other DBs NCBI-GeneID:  455232 NCBI-ProteinID:  XP_001169597 Ensembl:  ENSPTRG00000008671 VGNC:  12053 UniProt:  H2QC28 LinkDB All DBs Position 19:complement(17769887..17773193) Genome browser AA seq 211 aa AA seqDB search MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM GGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA LLSCSCPGNESKAGYRAPRSYPKSNSSKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggt ctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggtgacaacatc atcacggcccaggccatgtacaaggggctgtggatggactgcgttacgcagagcacgggg atgatgagctgcaaaatgtacgactcggtgctcgccctgtccgcggccttgcaggccact cgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatg ggcatgaagtgcacgcgctgtgggggagacgacaaagtgaagaaggcccgtatagccatg ggtggaggcataattttcatcgtggcaggtcttgccgccttggtagcttgctcctggtat ggccatcagattgtcacagacttttataaccctttgatccctaccaacattaagtatgag tttggccctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgca ctgctctcctgttcctgtcctgggaatgagagcaaggctgggtaccgtgcaccccgctct taccctaagtccaactcttccaaggagtatgtgtga

DBGET integrated database retrieval system