Pan troglodytes (chimpanzee): 455689 Help Entry 455689            CDS       T01005                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism ptr  Pan troglodytes (chimpanzee) Brite KEGG Orthology (KO) [BR:ptr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ptr03041]     455689 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     455689 (UBL5) Spliceosome [BR:ptr03041]  Complex B   Other components    Complex B specific factors     455689 (UBL5) Cytokines and neuropeptides [BR:ptr04052]  Neuropeptides   Unclassified    455689 (UBL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  455689 NCBI-ProteinID:  XP_512356 Ensembl:  ENSPTRG00000010451 VGNC:  6654 UniProt:  H2QFA3 A0A6D2XQQ5 LinkDB All DBs Position 20:12553831..12558532 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaggtccgcgttaaatgcaacacg gatgataccatcggggaccttaagaagctgattgcagcccaaactggtacccgttggaac aagattgtcctgaagaagtggtacacgatttttaaggaccacgtgtctctgggggactat gaaatccacgatgggatgaacctggagctttattatcaatag

DBGET integrated database retrieval system