Pan troglodytes (chimpanzee): 457260 Help Entry 457260            CDS       T01005                                  Symbol H2BC18 Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05203   Viral carcinogenesis ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     457260 (H2BC18)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     457260 (H2BC18)   09163 Immune disease    05322 Systemic lupus erythematosus     457260 (H2BC18)   09165 Substance dependence    05034 Alcoholism     457260 (H2BC18)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     457260 (H2BC18)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     457260 (H2BC18) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     457260 (H2BC18) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    457260 (H2BC18) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  457260 NCBI-ProteinID:  XP_016781574 VGNC:  83672 LinkDB All DBs Position 1:99410494..99428980 Genome browser AA seq 166 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSNPGNLSPTKPGGSEDRHPPPSQLSAIPPFCLVLRAGIAGQV NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcgaaatccgctcctgctcccaagaagggctccaaaaaggctgttacg aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtt tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggagaggcgtcccgc ctggcgcactacaacaagcgctccaccatcacctcccgcgagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctcgaacccggggaatctgtctccaactaagcctggtggcagtgaggac cgtcatccccctcccagccagctgtcagctatacctccattctgtctggttctcagggct ggaatcgctgggcaggtctag

DBGET integrated database retrieval system