Pan troglodytes (chimpanzee): 457306 Help Entry 457306            CDS       T01005                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04382   Cornified envelope formation ptr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     457306 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     457306 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     457306 (S100A10) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of microglial cells    457306 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  457306 NCBI-ProteinID:  XP_063653493 Ensembl:  ENSPTRG00000001302 VGNC:  1522 UniProt:  H2Q001 LinkDB All DBs Position 1:97211165..97222211 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaaccatgatgtttacatttcacaaattcgct ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac cagtgcagagatggcaaagtgggcttccagagcttcttttccctaattgcgggcctcacc attgcatgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system