KEGG   Pan troglodytes (chimpanzee): 457960
Entry
457960            CDS       T01005                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    457960 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptr04050]
    457960 (TNFRSF8)
   04090 CD molecules [BR:ptr04090]
    457960 (TNFRSF8)
Cytokine receptors [BR:ptr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   457960 (TNFRSF8)
CD molecules [BR:ptr04090]
 Proteins
  457960 (TNFRSF8)
SSDB
Other DBs
NCBI-GeneID: 457960
NCBI-ProteinID: XP_016809694
Ensembl: ENSPTRG00000000161
VGNC: 7012
LinkDB
Position
1:10757397..10837294
AA seq 652 aa
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPTGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
SCARCFFHSVCPAGMIVKFPGLLAVLGWRMRGKCVYAIFPESESQDVIPTQPPPFSQPQL
SAPSRHALGSTCTALLPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVS
PATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQ
CEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRICECRPGMICATSATNSCARCVPY
PICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENAEAPASTSPTQSSLVDSQASKT
LPIPTSAPVALSSTGKPVLDAGPVLFWVILVLAVVVGSSAFLLCHRRACRKRIRQKLHLC
YPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPIAEELGLMSQPLMETCHNVGAAYLESL
PLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGP
AEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgcgcgtcctcctcgccgcgctgggactgctgttcctgggggcgctacgagccttccca
caggatcgacccttcgaggacacctgtcatggaaaccccagccactactatgacaaggct
gtcaggaggtgctgttaccgctgccccacggggctgttcccgacacagcagtgcccacag
aggcctactgactgcaggaagcagtgtgagcctgactactacctggatgaggccgaccgc
tgtacagcctgcgtgacttgttctcgagacgacctcgtggagaagacgccgtgtgcgtgg
aactcctcccgtgtctgcgaatgtcgacctggcatgttctgttccacgtctgccgtcaac
tcctgtgcccgctgcttcttccattctgtctgtccggcagggatgattgtcaagttccca
gggcttttggcggttcttggctggaggatgaggggaaaatgtgtctacgccatcttccca
gaatcagagtctcaggatgtgatcccaacacagccccctcctttctcccagcctcagctc
tcagcaccaagccgtcacgctctgggctccacctgcactgcccttcttccaggcacggcg
cagaagaacactgtctgtgagccggcttccccaggggtcagccctgcctgtgccagccca
gagaactgcaaggaaccctccagtggcaccatcccccaggccaagcccaccccggtgtcc
ccagcaacctccagtgccagcaccatgcctgtaagagggggcacccgcctcgcccaggaa
gctgcttctaaactgacgagggctcccgactctccctcctctgtgggaaggcctagttca
gatccaggtctgtccccaacacagccatgcccagaggggtctggtgattgcaggaagcag
tgtgagcccgactactacctggatgaggccggccgctgcacggcctgcgtgagctgttct
cgagatgaccttgtggagaagacgccgtgtgcatggaactcctcccgcatctgcgaatgt
cgacctggcatgatctgtgccacatcagccaccaactcctgtgcccgctgtgtcccctac
ccaatctgtgcagcagagacagtcaccaagccccaggatatggctgagaaggacaccacc
tttgaggcaccacccctggggacccagccggactgcaaccccaccccagagaatgccgag
gcgcctgccagcaccagccccactcagagctcgctggtggactcccaggccagtaagacg
ctgcccatcccaaccagcgctcccgtcgctctctcctccacggggaagcccgttctggat
gcagggccagtgctcttctgggtgatcctggtgctggctgtggtggtcggctccagcgcc
ttcctcctgtgccaccggagggcctgcaggaagcgaattcggcagaagctccacctgtgc
tacccggtccagacctcccagcccaagctagagcttgtggattccagacccaggaggagc
tcaacgcagctgaggagtggtgcgtcggtgacagaacccatcgcggaagagctagggtta
atgagccagccactgatggagacctgccacaacgtgggggcagcctacctggagagcctg
ccgctgcaggatgccagcccggccgggggcccctcgtcccccagggaccttcctgagccc
cgggtgtccacggagcacaccaataacaagattgagaaaatctacatcatgaaggctgac
accgtgatcgtggggactgtgaaggctgagctgccggagggccggggcctggcggggcca
gcagagcccgagttggaggaggagctggaggcggaccataccccccactaccccgagcag
gagacagaaccgcctctgggcagctgcagcgatgtcatgctctcagtggaagaggaaggg
aaagaagaccccttgcccacagccgcctctggaaagtga

DBGET integrated database retrieval system