Pan troglodytes (chimpanzee): 458593 Help Entry 458593            CDS       T01005                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism ptr  Pan troglodytes (chimpanzee) Brite KEGG Orthology (KO) [BR:ptr00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ptr01002]     458593 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     458593 (CSTB) Peptidases and inhibitors [BR:ptr01002]  Peptidase inhibitors   Family I25: cystatin family    458593 (CSTB) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    458593 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light SQAPI Motif Other DBs NCBI-GeneID:  458593 NCBI-ProteinID:  NP_001009095 Ensembl:  ENSPTRG00000048077 VGNC:  14658 UniProt:  Q8I030 K7AXS4 A0A663DCY7 LinkDB All DBs Position 22:complement(44367326..44369424) Genome browser AA seq 98 aa AA seqDB search MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG DEEFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcgccctccgccacgcagccggccaccgccgagacccagcacatcgcc gaccaggtgaggtcccagcttgaagagaaagaaaacaagaagttccctgtgtttaaggcc gtgtcattcaagagccaggtggtcgcggggacaaactactttatcaaggtgcacgtcggc gacgaggagttcgtacacctgcgagtgttccaatctctccctcatgaaaacaagcccttg accttatctaactaccagaccaacaaagccaagcatgatgagctgacctatttctga

DBGET integrated database retrieval system