Pan troglodytes (chimpanzee): 460217 Help Entry 460217            CDS       T01005                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04014   Ras signaling pathway ptr04137   Mitophagy - animal ptr04144   Endocytosis ptr04145   Phagocytosis ptr04148   Efferocytosis ptr04962   Vasopressin-regulated water reabsorption ptr05014   Amyotrophic lateral sclerosis ptr05022   Pathways of neurodegeneration - multiple diseases ptr05132   Salmonella infection ptr05146   Amoebiasis ptr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     460217 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     460217 (RAB5A)    04145 Phagocytosis     460217 (RAB5A)    04137 Mitophagy - animal     460217 (RAB5A)    04148 Efferocytosis     460217 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     460217 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     460217 (RAB5A)    05152 Tuberculosis     460217 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     460217 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     460217 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     460217 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptr04131]     460217 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     460217 (RAB5A)    04031 GTP-binding proteins [BR:ptr04031]     460217 (RAB5A) Membrane trafficking [BR:ptr04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     460217 (RAB5A)  Endosome - Lysosome transport     460217 (RAB5A) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    460217 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    460217 (RAB5A)   Exosomal proteins of colorectal cancer cells    460217 (RAB5A)   Exosomal proteins of bladder cancer cells    460217 (RAB5A) GTP-binding proteins [BR:ptr04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     460217 (RAB5A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  460217 NCBI-ProteinID:  XP_016796052 Ensembl:  ENSPTRG00000014682 VGNC:  9693 UniProt:  K7DDJ1 H2QM62 LinkDB All DBs Position 2:23942970..23981279 Genome browser AA seq 216 aa AA seqDB search MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGGVDLTEPTQPTRNQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggctagtcgaggcgcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttatcaggaaacaaggccgacctagcaaataaa agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg gagacatccgctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggaggagta gaccttaccgaacccacacaaccaaccaggaatcagtgttgtagtaactaa

DBGET integrated database retrieval system