Pan troglodytes (chimpanzee): 461472 Help Entry 461472            CDS       T01005                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04151   PI3K-Akt signaling pathway ptr04625   C-type lectin receptor signaling pathway ptr04630   JAK-STAT signaling pathway ptr04658   Th1 and Th2 cell differentiation ptr04659   Th17 cell differentiation ptr04660   T cell receptor signaling pathway ptr04672   Intestinal immune network for IgA production ptr04940   Type I diabetes mellitus ptr05135   Yersinia infection ptr05142   Chagas disease ptr05162   Measles ptr05166   Human T-cell leukemia virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05200   Pathways in cancer ptr05320   Autoimmune thyroid disease ptr05321   Inflammatory bowel disease ptr05330   Allograft rejection ptr05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     461472 (IL2)    04151 PI3K-Akt signaling pathway     461472 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     461472 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     461472 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     461472 (IL2)    04660 T cell receptor signaling pathway     461472 (IL2)    04658 Th1 and Th2 cell differentiation     461472 (IL2)    04659 Th17 cell differentiation     461472 (IL2)    04672 Intestinal immune network for IgA production     461472 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     461472 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     461472 (IL2)    05171 Coronavirus disease - COVID-19     461472 (IL2)    05162 Measles     461472 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     461472 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     461472 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     461472 (IL2)    05321 Inflammatory bowel disease     461472 (IL2)    05330 Allograft rejection     461472 (IL2)    05332 Graft-versus-host disease     461472 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     461472 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     461472 (IL2)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     461472 (IL2) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interleukins    461472 (IL2) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Cytokines    461472 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Plasmid_RAQPRD Motif Other DBs NCBI-GeneID:  461472 NCBI-ProteinID:  XP_517425 Ensembl:  ENSPTRG00000016418 VGNC:  617 UniProt:  H2QQ44 A0A6D2X586 LinkDB All DBs Position 3:complement(123632003..123639559) Genome browser AA seq 153 aa AA seqDB search MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta agacccagggacttaatcagcaatatcaacgtaatagttctggaactaaagggatctgaa acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system