Pan troglodytes (chimpanzee): 463172 Help Entry 463172            CDS       T01005                                  Symbol H2BC9 Name (RefSeq) histone H2B type 1-H   KO K11252   histone H2B Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05203   Viral carcinogenesis ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     463172 (H2BC9)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     463172 (H2BC9)   09163 Immune disease    05322 Systemic lupus erythematosus     463172 (H2BC9)   09165 Substance dependence    05034 Alcoholism     463172 (H2BC9)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     463172 (H2BC9)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     463172 (H2BC9) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     463172 (H2BC9) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    463172 (H2BC9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  463172 NCBI-ProteinID:  XP_016810518 Ensembl:  ENSPTRG00000043345 VGNC:  83646 UniProt:  A0A5S6R7W8 A0A2I3S3G2 LinkDB All DBs Position 5:32218246..32219634 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagctaagtccgctcccgccccaaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggatggcaagaagcgtaaacgcagccgcaaggagagctactccgta tacgtttacaaggtgctgaagcaggtccaccccgacaccggcatctcctccaaagccatg gggatcatgaattcctttgtcaacgatatcttcgagcgcatcgccggcgaggcttcccgc ctggctcattacaacaagcgttcaaccatcacctccagggagatccagacagccgtgcgc ctgctgctgcctggggaactggccaagcacgccgtgtccgagggcactaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system