Pan troglodytes (chimpanzee): 463464 Help Entry 463464            CDS       T01005                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03272   Virion - Hepatitis viruses ptr04382   Cornified envelope formation ptr04514   Cell adhesion molecules ptr04530   Tight junction ptr04670   Leukocyte transendothelial migration ptr05160   Hepatitis C Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     463464 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     463464 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     463464 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     463464 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     463464 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     463464 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptr03037]     463464 (CLDN4)    04147 Exosome [BR:ptr04147]     463464 (CLDN4)    04515 Cell adhesion molecules [BR:ptr04515]     463464 (CLDN4) Cilium and associated proteins [BR:ptr03037]  Other cilia and associated proteins   Stereociliary proteins    463464 (CLDN4) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    463464 (CLDN4)   Exosomal proteins of colorectal cancer cells    463464 (CLDN4) Cell adhesion molecules [BR:ptr04515]  Immunoglobulin superfamily   L1 family    463464 (CLDN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM_230_134 TMEM37 DUF4131 Motif Other DBs NCBI-GeneID:  463464 NCBI-ProteinID:  XP_054511766 Ensembl:  ENSPTRG00000042699 ENSPTRG00000051682 VGNC:  13639 UniProt:  H2QUQ3 LinkDB All DBs Position 6:complement(82601368..82603975) Genome browser AA seq 209 aa AA seqDB search MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL LCCNCPPRTDKPYSAKYSAARSAAASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcctccatggggctacaggtaatgggcattgcgctggccgtcctgggctggctggcc gtcatgctgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatt gtcacctcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtgtacgactcgctgctggcactgccgcaggacctgcaggcggcc cgcgccctcgtcatcattagcatcatcgtggccgctctgggcgtgctgctgtccgtggtg gggggcaagtgtaccaactgcctggaggatgaaagcgccaaggccaagaccatgatcgtg gcgggcgtggtgttcctgttggccggccttatggtgatagtgcccgtgtcctggacggcc cacaacatcatccaagacttctacaatccactggtggcctccgggcagaagcgggagatg ggtgcctcgctctacgtcggctgggccgcctccggcctgctgctccttggcggggggctg ctttgctgcaactgtccaccccgcacagacaagccttactccgccaagtattctgctgcc cgctctgctgctgccagcaactacgtgtaa

DBGET integrated database retrieval system