KEGG   Pan troglodytes (chimpanzee): 465884
Entry
465884            CDS       T01005                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04145  Phagosome
ptr04148  Efferocytosis
ptr04151  PI3K-Akt signaling pathway
ptr04310  Wnt signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04517  IgSF CAM signaling
ptr04518  Integrin signaling
ptr04520  Adherens junction
ptr04530  Tight junction
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04810  Regulation of actin cytoskeleton
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04972  Pancreatic secretion
ptr05014  Amyotrophic lateral sclerosis
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05100  Bacterial invasion of epithelial cells
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05163  Human cytomegalovirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05208  Chemical carcinogenesis - reactive oxygen species
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05231  Choline metabolism in cancer
ptr05415  Diabetic cardiomyopathy
ptr05416  Viral myocarditis
ptr05417  Lipid and atherosclerosis
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    465884
   04014 Ras signaling pathway
    465884
   04015 Rap1 signaling pathway
    465884
   04310 Wnt signaling pathway
    465884
   04370 VEGF signaling pathway
    465884
   04071 Sphingolipid signaling pathway
    465884
   04024 cAMP signaling pathway
    465884
   04151 PI3K-Akt signaling pathway
    465884
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    465884
   04518 Integrin signaling
    465884
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    465884
   04148 Efferocytosis
    465884
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    465884
   04520 Adherens junction
    465884
   04530 Tight junction
    465884
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    465884
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    465884
   04620 Toll-like receptor signaling pathway
    465884
   04650 Natural killer cell mediated cytotoxicity
    465884
   04662 B cell receptor signaling pathway
    465884
   04664 Fc epsilon RI signaling pathway
    465884
   04666 Fc gamma R-mediated phagocytosis
    465884
   04670 Leukocyte transendothelial migration
    465884
   04062 Chemokine signaling pathway
    465884
  09154 Digestive system
   04972 Pancreatic secretion
    465884
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    465884
  09158 Development and regeneration
   04360 Axon guidance
    465884
   04380 Osteoclast differentiation
    465884
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    465884
   05205 Proteoglycans in cancer
    465884
   05208 Chemical carcinogenesis - reactive oxygen species
    465884
   05203 Viral carcinogenesis
    465884
   05231 Choline metabolism in cancer
    465884
  09162 Cancer: specific types
   05210 Colorectal cancer
    465884
   05212 Pancreatic cancer
    465884
   05211 Renal cell carcinoma
    465884
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    465884
   05163 Human cytomegalovirus infection
    465884
   05167 Kaposi sarcoma-associated herpesvirus infection
    465884
   05169 Epstein-Barr virus infection
    465884
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    465884
   05135 Yersinia infection
    465884
   05100 Bacterial invasion of epithelial cells
    465884
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    465884
   05020 Prion disease
    465884
   05022 Pathways of neurodegeneration - multiple diseases
    465884
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    465884
   05418 Fluid shear stress and atherosclerosis
    465884
   05415 Diabetic cardiomyopathy
    465884
   05416 Viral myocarditis
    465884
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    465884
   04933 AGE-RAGE signaling pathway in diabetic complications
    465884
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    465884
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    465884
   04031 GTP-binding proteins [BR:ptr04031]
    465884
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    465884
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    465884
  Macropinocytosis
   Ras GTPases
    465884
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    465884
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   465884
  Exosomal proteins of other body fluids (saliva and urine)
   465884
  Exosomal proteins of colorectal cancer cells
   465884
  Exosomal proteins of bladder cancer cells
   465884
GTP-binding proteins [BR:ptr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    465884
SSDB
Motif
Pfam: Ras Roc Lipase_GDSL_3
Other DBs
NCBI-GeneID: 465884
NCBI-ProteinID: XP_063660969
LinkDB
Position
X:complement(134878701..134879357)
AA seq 192 aa
MQAIKGVVVGDGAVGKTCLLISYTINAFPGEDIPTAFDNYSANVMVDGKLVNLGLWNTAG
QEDYDRLRPLSYPQADVFLICFSLVSPASFENVLAKWYPEVQHHCPNTPIILVGTKLDLR
DDKDRIQKLKEKKLTPITYPQGLAMAKEMGAVKYLECLALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLQL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagggtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaatcaacgcatttcctggagaagatatccctactgcctttgacaattat
tctgccaatgttatggtagatggaaaactggtgaatctgggcttatggaatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaagcagatgtgttcttaatt
tgcttttcgcttgtgagtcctgcatcatttgaaaatgtccttgcaaagtggtatcctgag
gtgcagcaccactgtcccaacactcccattatcctagtgggaactaaacttgatcttagg
gatgataaagacaggatccagaaactgaaggagaagaagctaactcccatcacctatccg
cagggtctagccatggctaaggagatgggtgctgtaaaatacctggagtgcttggccctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagctgtcctctgcccacct
cccgtgaagaagaggaagagaaaatgcctgcagttgtaa

DBGET integrated database retrieval system