Pan troglodytes (chimpanzee): 467426 Help Entry 467426            CDS       T01005                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04024   cAMP signaling pathway ptr04062   Chemokine signaling pathway ptr04064   NF-kappa B signaling pathway ptr04210   Apoptosis ptr04380   Osteoclast differentiation ptr04519   Cadherin signaling ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr04625   C-type lectin receptor signaling pathway ptr04657   IL-17 signaling pathway ptr04658   Th1 and Th2 cell differentiation ptr04659   Th17 cell differentiation ptr04660   T cell receptor signaling pathway ptr04662   B cell receptor signaling pathway ptr04668   TNF signaling pathway ptr04722   Neurotrophin signaling pathway ptr04920   Adipocytokine signaling pathway ptr04926   Relaxin signaling pathway ptr04931   Insulin resistance ptr04936   Alcoholic liver disease ptr05132   Salmonella infection ptr05134   Legionellosis ptr05135   Yersinia infection ptr05140   Leishmaniasis ptr05142   Chagas disease ptr05145   Toxoplasmosis ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05166   Human T-cell leukemia virus 1 infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05168   Herpes simplex virus 1 infection ptr05169   Epstein-Barr virus infection ptr05170   Human immunodeficiency virus 1 infection ptr05171   Coronavirus disease ptr05200   Pathways in cancer ptr05203   Viral carcinogenesis ptr05208   Chemical carcinogenesis - reactive oxygen species ptr05215   Prostate cancer ptr05220   Chronic myeloid leukemia ptr05222   Small cell lung cancer ptr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     467426 (NFKBIA)    04668 TNF signaling pathway     467426 (NFKBIA)    04024 cAMP signaling pathway     467426 (NFKBIA)   09133 Signaling molecules and interaction    04519 Cadherin signaling     467426 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     467426 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     467426 (NFKBIA)    04621 NOD-like receptor signaling pathway     467426 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     467426 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     467426 (NFKBIA)    04625 C-type lectin receptor signaling pathway     467426 (NFKBIA)    04660 T cell receptor signaling pathway     467426 (NFKBIA)    04658 Th1 and Th2 cell differentiation     467426 (NFKBIA)    04659 Th17 cell differentiation     467426 (NFKBIA)    04657 IL-17 signaling pathway     467426 (NFKBIA)    04662 B cell receptor signaling pathway     467426 (NFKBIA)    04062 Chemokine signaling pathway     467426 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     467426 (NFKBIA)    04926 Relaxin signaling pathway     467426 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     467426 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     467426 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     467426 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     467426 (NFKBIA)    05203 Viral carcinogenesis     467426 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     467426 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     467426 (NFKBIA)    05215 Prostate cancer     467426 (NFKBIA)    05222 Small cell lung cancer     467426 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     467426 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     467426 (NFKBIA)    05161 Hepatitis B     467426 (NFKBIA)    05160 Hepatitis C     467426 (NFKBIA)    05171 Coronavirus disease     467426 (NFKBIA)    05164 Influenza A     467426 (NFKBIA)    05162 Measles     467426 (NFKBIA)    05168 Herpes simplex virus 1 infection     467426 (NFKBIA)    05163 Human cytomegalovirus infection     467426 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     467426 (NFKBIA)    05169 Epstein-Barr virus infection     467426 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     467426 (NFKBIA)    05135 Yersinia infection     467426 (NFKBIA)    05134 Legionellosis     467426 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     467426 (NFKBIA)    05140 Leishmaniasis     467426 (NFKBIA)    05142 Chagas disease     467426 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     467426 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     467426 (NFKBIA)    04931 Insulin resistance     467426 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ptr03000]     467426 (NFKBIA)    04131 Membrane trafficking [BR:ptr04131]     467426 (NFKBIA) Transcription factors [BR:ptr03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     467426 (NFKBIA) Membrane trafficking [BR:ptr04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     467426 (NFKBIA) SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  467426 NCBI-ProteinID:  XP_522823 Ensembl:  ENSPTRG00000006265 VGNC:  8204 UniProt:  H2Q867 A0A6D2XF86 LinkDB All DBs Position 15:complement(33636341..33642564) Genome browser AA seq 317 aa AA seqDB search MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL NT seq 954 nt NT seq  +upstreamnt  +downstreamnt atgttccaggcggccgagcgcccccaggagtgggccatggagggcccccgcgacgggctg aagaaggagcggctactggacgaccgccacgacagcggcctggactccatgaaagacgag gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgttcctgcacttg gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac tacaatggccacacgtgtctacacttagcctctatccatggctacctgggcatcgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcc cttcacctcgcagtggacctgcagaatcctgacctggtgtcgctcctgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgacactagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacagag gacgagctgccctatgatgactgtgtgtttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system