Pan troglodytes (chimpanzee): 467981 Help Entry 467981            CDS       T01005                                  Symbol MT1B Name (RefSeq) metallothionein-1B   KO K14739   metallothionein 1/2 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     467981 (MT1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ptr03019]     467981 (MT1B)    03029 Mitochondrial biogenesis [BR:ptr03029]     467981 (MT1B) Messenger RNA biogenesis [BR:ptr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      467981 (MT1B) Mitochondrial biogenesis [BR:ptr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     467981 (MT1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  467981 NCBI-ProteinID:  XP_016785364 Ensembl:  ENSPTRG00000008139 VGNC:  107234 UniProt:  A0A6D2X394 H2QB55 LinkDB All DBs Position 18:54649012..54653415 Genome browser AA seq 61 aa AA seqDB search MDPNCSCTTGGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGSSEKCRCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgcaccacaggtggctcctgtgcctgcgccggctcctgcaag tgcaaagagtgcaaatgtacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgtgtctgcaaaggctcatcagagaagtgccgttgctgt gcctga

DBGET integrated database retrieval system