Pan troglodytes (chimpanzee): 467985 Help Entry 467985            CDS       T01005                                  Symbol CCL17 Name (RefSeq) C-C motif chemokine 17   KO K21083   C-C motif chemokine 17 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04625   C-type lectin receptor signaling pathway ptr04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     467985 (CCL17)    04061 Viral protein interaction with cytokine and cytokine receptor     467985 (CCL17)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     467985 (CCL17)    04657 IL-17 signaling pathway     467985 (CCL17)    04062 Chemokine signaling pathway     467985 (CCL17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     467985 (CCL17) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    467985 (CCL17) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  467985 NCBI-ProteinID:  XP_009429140 Ensembl:  ENSPTRG00000046463 VGNC:  13677 UniProt:  A0A6D2Y582 A0A2J8MW74 LinkDB All DBs Position 18:55410390..55412637 Genome browser AA seq 94 aa AA seqDB search MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggccccactgaagatgctggccctggtcaccctgctcctgggggcttctctgcagcac atccacgcagctcgagggaccaatgtgggccgggagtgctgcctggagtacttcaaggga gccattccccttagaaagctgaagacgtggtaccagacatctgaggactgctccagggat gccatcgtttttgtaactgtgcagggcagggccatctgttcggaccccaacaacaagaga gtgaagaatgcagttaaatacctgcaaagccttgagaggtcttga

DBGET integrated database retrieval system