Pan troglodytes (chimpanzee): 468313 Help Entry 468313            CDS       T01005                                  Name (RefSeq) calmodulin-2-like   KO K02183   calmodulin Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04014   Ras signaling pathway ptr04015   Rap1 signaling pathway ptr04020   Calcium signaling pathway ptr04022   cGMP-PKG signaling pathway ptr04024   cAMP signaling pathway ptr04070   Phosphatidylinositol signaling system ptr04114   Oocyte meiosis ptr04218   Cellular senescence ptr04261   Adrenergic signaling in cardiomyocytes ptr04270   Vascular smooth muscle contraction ptr04371   Apelin signaling pathway ptr04625   C-type lectin receptor signaling pathway ptr04713   Circadian entrainment ptr04720   Long-term potentiation ptr04722   Neurotrophin signaling pathway ptr04728   Dopaminergic synapse ptr04740   Olfactory transduction ptr04744   Phototransduction ptr04750   Inflammatory mediator regulation of TRP channels ptr04910   Insulin signaling pathway ptr04912   GnRH signaling pathway ptr04915   Estrogen signaling pathway ptr04916   Melanogenesis ptr04921   Oxytocin signaling pathway ptr04922   Glucagon signaling pathway ptr04924   Renin secretion ptr04925   Aldosterone synthesis and secretion ptr04970   Salivary secretion ptr04971   Gastric acid secretion ptr05010   Alzheimer disease ptr05012   Parkinson disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05031   Amphetamine addiction ptr05034   Alcoholism ptr05133   Pertussis ptr05152   Tuberculosis ptr05163   Human cytomegalovirus infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05170   Human immunodeficiency virus 1 infection ptr05200   Pathways in cancer ptr05214   Glioma ptr05417   Lipid and atherosclerosis ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     468313    04015 Rap1 signaling pathway     468313    04371 Apelin signaling pathway     468313    04020 Calcium signaling pathway     468313    04070 Phosphatidylinositol signaling system     468313    04024 cAMP signaling pathway     468313    04022 cGMP-PKG signaling pathway     468313  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     468313    04218 Cellular senescence     468313  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     468313   09152 Endocrine system    04910 Insulin signaling pathway     468313    04922 Glucagon signaling pathway     468313    04912 GnRH signaling pathway     468313    04915 Estrogen signaling pathway     468313    04921 Oxytocin signaling pathway     468313    04916 Melanogenesis     468313    04924 Renin secretion     468313    04925 Aldosterone synthesis and secretion     468313   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     468313    04270 Vascular smooth muscle contraction     468313   09154 Digestive system    04970 Salivary secretion     468313    04971 Gastric acid secretion     468313   09156 Nervous system    04728 Dopaminergic synapse     468313    04720 Long-term potentiation     468313    04722 Neurotrophin signaling pathway     468313   09157 Sensory system    04744 Phototransduction     468313    04740 Olfactory transduction     468313    04750 Inflammatory mediator regulation of TRP channels     468313   09159 Environmental adaptation    04713 Circadian entrainment     468313  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     468313   09162 Cancer: specific types    05214 Glioma     468313   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     468313    05163 Human cytomegalovirus infection     468313    05167 Kaposi sarcoma-associated herpesvirus infection     468313   09171 Infectious disease: bacterial    05133 Pertussis     468313    05152 Tuberculosis     468313   09164 Neurodegenerative disease    05010 Alzheimer disease     468313    05012 Parkinson disease     468313    05022 Pathways of neurodegeneration - multiple diseases     468313   09165 Substance dependence    05031 Amphetamine addiction     468313    05034 Alcoholism     468313   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     468313    05418 Fluid shear stress and atherosclerosis     468313  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptr01009]     468313   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptr04131]     468313    03036 Chromosome and associated proteins [BR:ptr03036]     468313   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     468313 Protein phosphatases and associated proteins [BR:ptr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      468313 Membrane trafficking [BR:ptr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     468313 Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      468313 Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    468313 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 CFAP251_C EF-hand_FSTL1 EFhand_Ca_insen RloB Motif Other DBs NCBI-GeneID:  468313 NCBI-ProteinID:  XP_054526894 LinkDB All DBs Position 19:83214941..83215341 Genome browser AA seq 86 aa AA seqDB search MINEVDADGNRTDSPEFLTMMARKMKDTQSEEEIREAFLVFDKDGNGYISAAELCHVMTN PGEKLTDDKVDEMIREAGIDGDGQVN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgattaatgaagtagatgctgatggtaatagaacggactctcctgaatttctgacaatg atggcaagaaaaatgaaagacacacaaagtgaagaagaaattagagaagccttccttgtg tttgataaggatggcaatggctatatcagtgcagcagaactttgccatgtgatgacaaac cccggagagaagctaacagacgacaaggttgatgaaatgatcagggaagcaggtattgat ggtgatggtcaggtaaactag

DBGET integrated database retrieval system