Pan troglodytes (chimpanzee): 468372 Help Entry 468372            CDS       T01005                                  Symbol UBB Name (RefSeq) polyubiquitin-B   KO K08770   ubiquitin B/C Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04120   Ubiquitin mediated proteolysis ptr04137   Mitophagy - animal ptr04140   Autophagy - animal ptr05012   Parkinson disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     468372 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     468372 (UBB)    04137 Mitophagy - animal     468372 (UBB)  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     468372 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     468372 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     468372 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     468372 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ptr04121]     468372 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     468372 (UBB) Ubiquitin system [BR:ptr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    468372 (UBB) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of breast milk    468372 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    468372 (UBB)   Exosomal proteins of colorectal cancer cells    468372 (UBB)   Exosomal proteins of bladder cancer cells    468372 (UBB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 Dsc3_N OTU1_UBXL Motif Other DBs NCBI-GeneID:  468372 NCBI-ProteinID:  NP_001009117 UniProt:  P0CG65 A0A8I3B201 A0A2J8J3G7 LinkDB All DBs Position 19:complement(53619609..53621163) Genome browser AA seq 229 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 690 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaaaacccttaccggcaagaccatcacccttgaggtggagcccagt gacaccatcgaaaatgtgaaggccaagatccaggataaggaaggcatccctcccgaccag cagaggctcatctttgcaggcaagcagctggaagatggccgtactctttctgactacaac atccagaaggagtcgaccctgcatctggtcctgcgtctgagaggtggtatgcagatcttc gtgaagaccctgactggcaagaccatcaccctggaagtggagcccagtgacaccatcgaa aatgtgaaggccaagatccaggataaagaaggcatccctcccgaccagcagaggctcatc tttgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaggag tcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttcgtgaagaccctg accggcaagaccatcactctggaggtggagcccagtgacaccatcgaaaatgtgaaggcc aagatccaagataaagaaggcatccctcccgaccagcagaggctcatctttgcaggcaag cagctggaagatggccgcactctttctgactacaacatccagaaagagtcgaccctgcac ctggtcctgcgcctgaggggtggctgttaa

DBGET integrated database retrieval system