Pan troglodytes (chimpanzee): 468760 Help Entry 468760            CDS       T01005                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04140   Autophagy - animal ptr04144   Endocytosis ptr04152   AMPK signaling pathway ptr04530   Tight junction ptr04972   Pancreatic secretion ptr05014   Amyotrophic lateral sclerosis ptr05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     468760 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     468760 (RAB8A)    04140 Autophagy - animal     468760 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     468760 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     468760 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     468760 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     468760 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptr04131]     468760 (RAB8A)    03036 Chromosome and associated proteins [BR:ptr03036]     468760 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     468760 (RAB8A)    04031 GTP-binding proteins [BR:ptr04031]     468760 (RAB8A) Membrane trafficking [BR:ptr04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     468760 (RAB8A)  Autophagy   Other autophagy associated proteins     468760 (RAB8A) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     468760 (RAB8A) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    468760 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    468760 (RAB8A)   Exosomal proteins of colorectal cancer cells    468760 (RAB8A) GTP-binding proteins [BR:ptr04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     468760 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  468760 NCBI-ProteinID:  NP_001229300 Ensembl:  ENSPTRG00000010639 VGNC:  7571 UniProt:  G2HFP6 A0A6D2XR50 LinkDB All DBs Position 20:18766365..18788565 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDHQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag atatgggacacggccggtcaggaacggtttcggacgatcacaacggcctactacaggggt gcaatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaacgtggaaaat gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccaccagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system