Pan troglodytes (chimpanzee): 471205 Help Entry 471205            CDS       T01005                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04064   NF-kappa B signaling pathway ptr04072   Phospholipase D signaling pathway ptr04218   Cellular senescence ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04657   IL-17 signaling pathway ptr04932   Non-alcoholic fatty liver disease ptr04933   AGE-RAGE signaling pathway in diabetic complications ptr04936   Alcoholic liver disease ptr05132   Salmonella infection ptr05133   Pertussis ptr05134   Legionellosis ptr05135   Yersinia infection ptr05142   Chagas disease ptr05144   Malaria ptr05146   Amoebiasis ptr05161   Hepatitis B ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05171   Coronavirus disease - COVID-19 ptr05200   Pathways in cancer ptr05202   Transcriptional misregulation in cancer ptr05219   Bladder cancer ptr05323   Rheumatoid arthritis ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     471205 (CXCL8)    04072 Phospholipase D signaling pathway     471205 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     471205 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     471205 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     471205 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     471205 (CXCL8)    04621 NOD-like receptor signaling pathway     471205 (CXCL8)    04622 RIG-I-like receptor signaling pathway     471205 (CXCL8)    04657 IL-17 signaling pathway     471205 (CXCL8)    04062 Chemokine signaling pathway     471205 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     471205 (CXCL8)    05202 Transcriptional misregulation in cancer     471205 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     471205 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     471205 (CXCL8)    05171 Coronavirus disease - COVID-19     471205 (CXCL8)    05164 Influenza A     471205 (CXCL8)    05163 Human cytomegalovirus infection     471205 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     471205 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     471205 (CXCL8)    05135 Yersinia infection     471205 (CXCL8)    05133 Pertussis     471205 (CXCL8)    05134 Legionellosis     471205 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     471205 (CXCL8)    05144 Malaria     471205 (CXCL8)    05142 Chagas disease     471205 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     471205 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     471205 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     471205 (CXCL8)    04932 Non-alcoholic fatty liver disease     471205 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     471205 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     471205 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     471205 (CXCL8) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    471205 (CXCL8) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Chemokines    471205 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  471205 NCBI-ProteinID:  XP_001156432 Ensembl:  ENSPTRG00000016154 VGNC:  8664 UniProt:  H2QPN2 A0A663D9V6 LinkDB All DBs Position 3:complement(56367710..56372451) Genome browser AA seq 99 aa AA seqDB search MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacgtac tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac tgcgccaatacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa

DBGET integrated database retrieval system