Pan troglodytes (chimpanzee): 473193 Help Entry 473193            CDS       T01005                                  Symbol IFNA14 Name (RefSeq) interferon alpha-14   KO K05414   interferon alpha Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04151   PI3K-Akt signaling pathway ptr04217   Necroptosis ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr04630   JAK-STAT signaling pathway ptr04650   Natural killer cell mediated cytotoxicity ptr04936   Alcoholic liver disease ptr05152   Tuberculosis ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05165   Human papillomavirus infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05168   Herpes simplex virus 1 infection ptr05169   Epstein-Barr virus infection ptr05170   Human immunodeficiency virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05200   Pathways in cancer ptr05320   Autoimmune thyroid disease ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     473193 (IFNA14)    04151 PI3K-Akt signaling pathway     473193 (IFNA14)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     473193 (IFNA14)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     473193 (IFNA14)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     473193 (IFNA14)    04621 NOD-like receptor signaling pathway     473193 (IFNA14)    04622 RIG-I-like receptor signaling pathway     473193 (IFNA14)    04623 Cytosolic DNA-sensing pathway     473193 (IFNA14)    04650 Natural killer cell mediated cytotoxicity     473193 (IFNA14)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     473193 (IFNA14)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     473193 (IFNA14)    05161 Hepatitis B     473193 (IFNA14)    05160 Hepatitis C     473193 (IFNA14)    05171 Coronavirus disease - COVID-19     473193 (IFNA14)    05164 Influenza A     473193 (IFNA14)    05162 Measles     473193 (IFNA14)    05168 Herpes simplex virus 1 infection     473193 (IFNA14)    05163 Human cytomegalovirus infection     473193 (IFNA14)    05167 Kaposi sarcoma-associated herpesvirus infection     473193 (IFNA14)    05169 Epstein-Barr virus infection     473193 (IFNA14)    05165 Human papillomavirus infection     473193 (IFNA14)   09171 Infectious disease: bacterial    05152 Tuberculosis     473193 (IFNA14)   09163 Immune disease    05320 Autoimmune thyroid disease     473193 (IFNA14)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     473193 (IFNA14)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     473193 (IFNA14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     473193 (IFNA14) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interferons    473193 (IFNA14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND CoV_NSP2_N Motif Other DBs NCBI-GeneID:  473193 NCBI-ProteinID:  XP_528563 Ensembl:  ENSPTRG00000044822 VGNC:  8897 UniProt:  A0A2I3S4K6 A0A6D2W7B8 A0A7R8C2Z8 LinkDB All DBs Position 11:94652256..94653292 Genome browser AA seq 219 aa AA seqDB search MHRARSSENLQPKVQCYPSSTSPAASSGFPMALPFALMMALVVLSCKSSCSLGCDLSQTH SLNNRRTLMLMTQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMIQQTFNL FSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRI TLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atgcacagagcaaggtcttcagaaaacctacaacccaaggttcagtgttacccctcatca accagcccagcagcatcttcgggattcccaatggcgttgccctttgctttaatgatggcc ctggtggtgctcagctgcaagtcaagctgctctctgggctgtgatctgtctcaaacccac agcctgaataacaggaggactttgatgcttatgacacaaatgaggagaatctctcctttc tcctgcctgaaggacagacatgactttgaatttccccaggaggaatttgatggcaaccag tttcagaaagctcaagccatctctgtcctccatgagatgatccagcagaccttcaatctc ttcagcacaaagaactcatctgctgcttgggatgagaccctcctagaaaaattctacatt gaacttttccagcaaatgaatgacctggaagcctgtgtgatacaggaggttggggtggaa gagactcccctgatgaatgaggactctatcctggctgtgaagaaatacttccaaagaatc actctttatctgatggagaagaaatacagcccttgtgcctgggaggttgtcagagcagaa atcatgagatccctctctttttcaacaaacttgcaaaaaagattaaggaggaaggattga

DBGET integrated database retrieval system