Pan troglodytes (chimpanzee): 473199 Help Entry 473199            CDS       T01005                                  Symbol IFNA8 Name (RefSeq) interferon alpha-8   KO K05414   interferon alpha Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04151   PI3K-Akt signaling pathway ptr04217   Necroptosis ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr04630   JAK-STAT signaling pathway ptr04650   Natural killer cell mediated cytotoxicity ptr04936   Alcoholic liver disease ptr05152   Tuberculosis ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05165   Human papillomavirus infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05168   Herpes simplex virus 1 infection ptr05169   Epstein-Barr virus infection ptr05170   Human immunodeficiency virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05200   Pathways in cancer ptr05320   Autoimmune thyroid disease ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     473199 (IFNA8)    04151 PI3K-Akt signaling pathway     473199 (IFNA8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     473199 (IFNA8)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     473199 (IFNA8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     473199 (IFNA8)    04621 NOD-like receptor signaling pathway     473199 (IFNA8)    04622 RIG-I-like receptor signaling pathway     473199 (IFNA8)    04623 Cytosolic DNA-sensing pathway     473199 (IFNA8)    04650 Natural killer cell mediated cytotoxicity     473199 (IFNA8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     473199 (IFNA8)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     473199 (IFNA8)    05161 Hepatitis B     473199 (IFNA8)    05160 Hepatitis C     473199 (IFNA8)    05171 Coronavirus disease - COVID-19     473199 (IFNA8)    05164 Influenza A     473199 (IFNA8)    05162 Measles     473199 (IFNA8)    05168 Herpes simplex virus 1 infection     473199 (IFNA8)    05163 Human cytomegalovirus infection     473199 (IFNA8)    05167 Kaposi sarcoma-associated herpesvirus infection     473199 (IFNA8)    05169 Epstein-Barr virus infection     473199 (IFNA8)    05165 Human papillomavirus infection     473199 (IFNA8)   09171 Infectious disease: bacterial    05152 Tuberculosis     473199 (IFNA8)   09163 Immune disease    05320 Autoimmune thyroid disease     473199 (IFNA8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     473199 (IFNA8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     473199 (IFNA8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     473199 (IFNA8) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interferons    473199 (IFNA8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  473199 NCBI-ProteinID:  XP_528569 Ensembl:  ENSPTRG00000045477 VGNC:  8898 UniProt:  A0A2I3T4W8 A0A6D2XX68 LinkDB All DBs Position 11:complement(94484027..94485095) Genome browser AA seq 189 aa AA seqDB search MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALVLLAQMKRISPFSCLKDRHDFE FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLE SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSIN LQKRLKSKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgactttttatttactggtggccctagtggtgctcagctacaagtcattcagc tctctgggctgtgatctgcctcagacccacagcctgggtaacaggagggccttggtcctc ctggcacaaatgaaaagaatctctcctttctcctgcctgaaggacagacatgactttgaa ttcccccaggaggagtttgatgataaacagttccagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaacctcttcagcacaaaggactcatctgctgctttg gatgagacccttctagatgaattctacatcgaacttgaccagcagctgaatgacctggag tcctgtgtgatgcaggaagtgggggtgatagagtctcccctgatgtacgaggactccatc ctggctgtgaggaaatacttccaaagaatcactctatatctgacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac ttgcaaaaaagattgaagagtaaggaatga

DBGET integrated database retrieval system