Pan troglodytes (chimpanzee): 473608 Help Entry 473608            CDS       T01005                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05202   Transcriptional misregulation in cancer ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     473608  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     473608   09163 Immune disease    05322 Systemic lupus erythematosus     473608   09165 Substance dependence    05034 Alcoholism     473608  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     473608   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     473608 Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     473608 Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    473608 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  473608 NCBI-ProteinID:  XP_009437372 LinkDB All DBs Position X:50942083..50942511 Genome browser AA seq 142 aa AA seqDB search MARTRWTARKSTGGIAPRKQLATKATCKSAPSTGGVKKPHRYRPGTVALREIRHYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGTLQEASEAYLVGLFEDTNLCAIHATRVTI MPKDIQLARHIRGERVSEYTMM NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaggtggactgcccgcaaatctaccggtggtatagcacccaggaagcaa ctggctacaaaagccacttgtaagagtgcgccctctactggaggggtgaagaaacctcat cgttacagacctggtactgtggcactccgtgaaattagacattatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaatcgctcaggactttaaa acagatctgcgcttccagagcgcagctatcggtactttgcaggaggcaagtgaggcctat ctagttggcctttttgaagacaccaacctgtgtgctatccatgccacacgtgtaacaatt atgccaaaagacatccagctagcacgccacatacgtggagaacgtgtttcagaatacacc atgatgtga

DBGET integrated database retrieval system