Pan troglodytes (chimpanzee): 473843 Help Entry 473843            CDS       T01005                                  Symbol H2BW2 Name (RefSeq) histone H2B type W-T-like   KO K11252   histone H2B Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05203   Viral carcinogenesis ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     473843 (H2BW2)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     473843 (H2BW2)   09163 Immune disease    05322 Systemic lupus erythematosus     473843 (H2BW2)   09165 Substance dependence    05034 Alcoholism     473843 (H2BW2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     473843 (H2BW2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     473843 (H2BW2) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     473843 (H2BW2) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    473843 (H2BW2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF TFIID_20kDa CENP-S Motif Other DBs NCBI-GeneID:  473843 NCBI-ProteinID:  XP_016798703 Ensembl:  ENSPTRG00000042159 VGNC:  83691 UniProt:  H2RIB9 LinkDB All DBs Position X:101541825..101542888 Genome browser AA seq 153 aa AA seqDB search MAAASTMVGPSSETPSEEQLITQEPKEANSTTAQKQSKQRKRRCRGPRRCHANCRGDSFA TYFSRVLKPVHQGLSLSQEAVSVMDSMVPNILDRIGTKAGRLARYTKRMTITSRDIQMAV RLLLPGKMGKFAESQGTNAALRTSLCAIWQQRK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctgctgcctccaccatggtgggaccttcctctgagacgccatctgaggaacagttg attacccaggagcccaaagaggccaactccacgacggcccagaagcagagcaagcagagg aagcgaaggtgccgtgggccccgcaggtgccatgccaactgtcgtggggacagcttcgcc acctatttcagccgggtgctgaagccggttcaccagggcctcagcctttcccaggaggcc gtgagtgtcatggattctatggttcctaacatactggaccgcatcggcaccaaggctggt cgcctcgcccgttacaccaagcgcatgaccatcacctcccgggacatccagatggccgtg cgcctgctgctgccggggaagatgggcaagttcgctgagtctcagggcacgaatgccgcc ctcagaacttcattatgtgcgatatggcaacagagaaagtga

DBGET integrated database retrieval system