Pan troglodytes (chimpanzee): 494185 Help Entry 494185            CDS       T01005                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha precursor   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04064   NF-kappa B signaling pathway ptr04668   TNF signaling pathway ptr04940   Type I diabetes mellitus ptr05166   Human T-cell leukemia virus 1 infection ptr05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     494185 (LTA)    04668 TNF signaling pathway     494185 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     494185 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     494185 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     494185 (LTA)    05168 Herpes simplex virus 1 infection     494185 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     494185 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     494185 (LTA) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Tumor necrosis fators    494185 (LTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  494185 NCBI-ProteinID:  NP_001038975 Ensembl:  ENSPTRG00000017964 VGNC:  11106 UniProt:  P61125 A0A663DF78 A0A2J8NXP8 LinkDB All DBs Position 5:37368611..37371455 Genome browser AA seq 205 aa AA seqDB search MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ LSTHTDGIPHLVLSPSTVFFGAFAL NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacaccacctgaacgtctcttcctcccaagggtgcgtggcaccaccctacacctcctc cttctggggctgctgctggttctgctgcctggggcccaggggctccctggtgttggcctc acaccttcagctgcccagactgcccgtcagcaccccaagatgcatcttgcccacagcacc ctcaaacctgctgctcacctcattggagaccccagcaagcagaactcactgctctggaga gcaaacacggaccgtgccttcctccaggatggtttctccttgagcaacaattctctcctg gtccccaccagtggcatctacttcgtctactcccaggtggtcttctctgggaaagcctac tctcccaaggccacctcctccccactctacctggcccatgaggtccagctcttctcctcc cagtaccccttccacgtgcctctcctcagctcccagaagatggtgtatccagggctgcag gaaccctggctgcactcgatgtaccatggggctgcgttccagctcacccagggagaccag ctatccacccacacagatggcatcccccacctagtcctcagccctagtactgtcttcttt ggagccttcgctctgtag

DBGET integrated database retrieval system