Pan troglodytes (chimpanzee): 736020 Help Entry 736020            CDS       T01005                                  Symbol MT1L Name (RefSeq) metallothionein-1L   KO K14739   metallothionein 1/2 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     736020 (MT1L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ptr03019]     736020 (MT1L)    03029 Mitochondrial biogenesis [BR:ptr03029]     736020 (MT1L) Messenger RNA biogenesis [BR:ptr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      736020 (MT1L) Mitochondrial biogenesis [BR:ptr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     736020 (MT1L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  736020 NCBI-ProteinID:  XP_003339329 Ensembl:  ENSPTRG00000050915 LinkDB All DBs Position 18:54622551..54624314 Genome browser AA seq 61 aa AA seqDB search MDPNCSCATGVSCACASSCKCKECKCTSCKKSCCSCCPMGCAKCAQGCVCKGESEKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccactggtgtctcctgcgcctgcgccagctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccatgggc tgtgccaagtgtgcccagggctgcgtctgcaaaggggagtcggagaagtgcagctgctgt gcctga

DBGET integrated database retrieval system