Pan troglodytes (chimpanzee): 736325 Help Entry 736325            CDS       T01005                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04010   MAPK signaling pathway ptr04020   Calcium signaling pathway ptr04022   cGMP-PKG signaling pathway ptr04114   Oocyte meiosis ptr04218   Cellular senescence ptr04310   Wnt signaling pathway ptr04360   Axon guidance ptr04370   VEGF signaling pathway ptr04380   Osteoclast differentiation ptr04625   C-type lectin receptor signaling pathway ptr04650   Natural killer cell mediated cytotoxicity ptr04658   Th1 and Th2 cell differentiation ptr04659   Th17 cell differentiation ptr04660   T cell receptor signaling pathway ptr04662   B cell receptor signaling pathway ptr04720   Long-term potentiation ptr04724   Glutamatergic synapse ptr04921   Oxytocin signaling pathway ptr04922   Glucagon signaling pathway ptr04924   Renin secretion ptr05010   Alzheimer disease ptr05014   Amyotrophic lateral sclerosis ptr05020   Prion disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05031   Amphetamine addiction ptr05152   Tuberculosis ptr05163   Human cytomegalovirus infection ptr05166   Human T-cell leukemia virus 1 infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05170   Human immunodeficiency virus 1 infection ptr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     736325 (PPP3R2)    04310 Wnt signaling pathway     736325 (PPP3R2)    04370 VEGF signaling pathway     736325 (PPP3R2)    04020 Calcium signaling pathway     736325 (PPP3R2)    04022 cGMP-PKG signaling pathway     736325 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     736325 (PPP3R2)    04218 Cellular senescence     736325 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     736325 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     736325 (PPP3R2)    04660 T cell receptor signaling pathway     736325 (PPP3R2)    04658 Th1 and Th2 cell differentiation     736325 (PPP3R2)    04659 Th17 cell differentiation     736325 (PPP3R2)    04662 B cell receptor signaling pathway     736325 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     736325 (PPP3R2)    04921 Oxytocin signaling pathway     736325 (PPP3R2)    04924 Renin secretion     736325 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     736325 (PPP3R2)    04720 Long-term potentiation     736325 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     736325 (PPP3R2)    04380 Osteoclast differentiation     736325 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     736325 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     736325 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     736325 (PPP3R2)    05163 Human cytomegalovirus infection     736325 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     736325 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     736325 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     736325 (PPP3R2)    05014 Amyotrophic lateral sclerosis     736325 (PPP3R2)    05020 Prion disease     736325 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     736325 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     736325 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     736325 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptr01009]     736325 (PPP3R2) Protein phosphatases and associated proteins [BR:ptr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      736325 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  736325 NCBI-ProteinID:  NP_001230035 UniProt:  A0A2J8LPR5 LinkDB All DBs Position 11:36823074..36823686 Genome browser AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTDGDGEVDFKEFILGTSQFSVKGNEEQKLRFAFSIYDMDKDGYISNGELFQVLK MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg gggacctcccagttcagcgtcaagggcaacgaggagcagaagttgaggtttgcgttcagc atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgacggactggcagctccagcagctggtcgacaaaaccatc atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system