Pan troglodytes (chimpanzee): 736543 Help Entry 736543            CDS       T01005                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     736543 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     736543 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     736543 (CCL22)    04062 Chemokine signaling pathway     736543 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     736543 (CCL22) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    736543 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  736543 NCBI-ProteinID:  XP_001136513 Ensembl:  ENSPTRG00000047829 VGNC:  13678 UniProt:  A0A6D2W5A1 A0A2I3SMD5 LinkDB All DBs Position 18:55352981..55361257 Genome browser AA seq 93 aa AA seqDB search MARLQTTLLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSC PRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctcgcctacagaccacactcctggttgtccttgtcctccttgctgtggcgcttcaa gcaactgaggcaggcccctacggcgccaacatggaagacagcgtctgctgccgtgattac gtccgttaccgtctgcccctgcgcgtggtgaaacacttctactggacctcagactcctgc ccgagacctggcgtggtgttgctaaccttcagggataaggagatctgtgccgatcccaga gtgccctgggtgaagatgattctcaataagctgagccaatga

DBGET integrated database retrieval system