Pan troglodytes (chimpanzee): 736904 Help Entry 736904            CDS       T01005                                  Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03410   Base excision repair ptr04140   Autophagy - animal ptr04217   Necroptosis ptr04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     736904  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     736904  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     736904  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     736904    03400 DNA repair and recombination proteins [BR:ptr03400]     736904   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     736904 Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     736904 DNA repair and recombination proteins [BR:ptr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      736904    MMR (mismatch excision repair)     Other MMR factors      736904 Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    736904 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 Motif Other DBs NCBI-GeneID:  736904 NCBI-ProteinID:  XP_054537535 LinkDB All DBs Position 2:26385881..26387080 Genome browser AA seq 210 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKEETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SVGDVAKKLGEMWNNAAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEEDDDDE NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattttttgtg caaacttgtcgggaggagcataagaagaagcacccagatgcttcagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagatatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacctatatccct cccaaagaggagacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gccttcttcctcttctgctctgagtatcgcccaaaaatcaaaggagaacatcctggcctg tccgttggtgatgttgcgaagaaactgggagagatgtggaataacgctgctgcagatgac aagcagccttatgaaaagaaggctgcgaagctgaaggaaaaatacgaaaaggatattgct gcgtatcgagctaaaggaaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag gaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system