Pan troglodytes (chimpanzee): 738114 Help Entry 738114            CDS       T01005                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04814   Motor proteins ptr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     738114 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     738114 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptr03037]     738114 (DYNLT3)    04812 Cytoskeleton proteins [BR:ptr04812]     738114 (DYNLT3) Cilium and associated proteins [BR:ptr03037]  Motile cilia and associated proteins   Dynein arm    738114 (DYNLT3) Cytoskeleton proteins [BR:ptr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      738114 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  738114 NCBI-ProteinID:  XP_001136823 Ensembl:  ENSPTRG00000021793 VGNC:  14688 UniProt:  K7A1B1 A0A6D2XTA3 LinkDB All DBs Position X:complement(38267175..38275948) Genome browser AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgacgaggttggcttcaatgctgaggaagcccacaat attgtcaaagagtgtgtagatggggttttaggtggtgaagattataatcacaacaacatc aaccagtggactgcaagcatagtggaacaatccttaacacatctggttaagttgggaaaa gcttataaatatattgtgacctgtgcagtggtccagaagagcgcatatggctttcacaca gccagctcctgtttttgggataccacatctgatggaacctgtaccgtaagatgggagaac cggaccatgaactgtattgtcaacgtttttgccattgctattgttctttaa

DBGET integrated database retrieval system