Pan troglodytes (chimpanzee): 738819 Help Entry 738819            CDS       T01005                                  Symbol CALM1 Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04014   Ras signaling pathway ptr04015   Rap1 signaling pathway ptr04020   Calcium signaling pathway ptr04022   cGMP-PKG signaling pathway ptr04024   cAMP signaling pathway ptr04070   Phosphatidylinositol signaling system ptr04114   Oocyte meiosis ptr04218   Cellular senescence ptr04261   Adrenergic signaling in cardiomyocytes ptr04270   Vascular smooth muscle contraction ptr04371   Apelin signaling pathway ptr04625   C-type lectin receptor signaling pathway ptr04713   Circadian entrainment ptr04720   Long-term potentiation ptr04722   Neurotrophin signaling pathway ptr04728   Dopaminergic synapse ptr04740   Olfactory transduction ptr04744   Phototransduction ptr04750   Inflammatory mediator regulation of TRP channels ptr04910   Insulin signaling pathway ptr04912   GnRH signaling pathway ptr04915   Estrogen signaling pathway ptr04916   Melanogenesis ptr04921   Oxytocin signaling pathway ptr04922   Glucagon signaling pathway ptr04924   Renin secretion ptr04925   Aldosterone synthesis and secretion ptr04970   Salivary secretion ptr04971   Gastric acid secretion ptr05010   Alzheimer disease ptr05012   Parkinson disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05031   Amphetamine addiction ptr05034   Alcoholism ptr05133   Pertussis ptr05152   Tuberculosis ptr05163   Human cytomegalovirus infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05170   Human immunodeficiency virus 1 infection ptr05200   Pathways in cancer ptr05214   Glioma ptr05417   Lipid and atherosclerosis ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     738819 (CALM1)    04015 Rap1 signaling pathway     738819 (CALM1)    04371 Apelin signaling pathway     738819 (CALM1)    04020 Calcium signaling pathway     738819 (CALM1)    04070 Phosphatidylinositol signaling system     738819 (CALM1)    04024 cAMP signaling pathway     738819 (CALM1)    04022 cGMP-PKG signaling pathway     738819 (CALM1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     738819 (CALM1)    04218 Cellular senescence     738819 (CALM1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     738819 (CALM1)   09152 Endocrine system    04910 Insulin signaling pathway     738819 (CALM1)    04922 Glucagon signaling pathway     738819 (CALM1)    04912 GnRH signaling pathway     738819 (CALM1)    04915 Estrogen signaling pathway     738819 (CALM1)    04921 Oxytocin signaling pathway     738819 (CALM1)    04916 Melanogenesis     738819 (CALM1)    04924 Renin secretion     738819 (CALM1)    04925 Aldosterone synthesis and secretion     738819 (CALM1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     738819 (CALM1)    04270 Vascular smooth muscle contraction     738819 (CALM1)   09154 Digestive system    04970 Salivary secretion     738819 (CALM1)    04971 Gastric acid secretion     738819 (CALM1)   09156 Nervous system    04728 Dopaminergic synapse     738819 (CALM1)    04720 Long-term potentiation     738819 (CALM1)    04722 Neurotrophin signaling pathway     738819 (CALM1)   09157 Sensory system    04744 Phototransduction     738819 (CALM1)    04740 Olfactory transduction     738819 (CALM1)    04750 Inflammatory mediator regulation of TRP channels     738819 (CALM1)   09159 Environmental adaptation    04713 Circadian entrainment     738819 (CALM1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     738819 (CALM1)   09162 Cancer: specific types    05214 Glioma     738819 (CALM1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     738819 (CALM1)    05163 Human cytomegalovirus infection     738819 (CALM1)    05167 Kaposi sarcoma-associated herpesvirus infection     738819 (CALM1)   09171 Infectious disease: bacterial    05133 Pertussis     738819 (CALM1)    05152 Tuberculosis     738819 (CALM1)   09164 Neurodegenerative disease    05010 Alzheimer disease     738819 (CALM1)    05012 Parkinson disease     738819 (CALM1)    05022 Pathways of neurodegeneration - multiple diseases     738819 (CALM1)   09165 Substance dependence    05031 Amphetamine addiction     738819 (CALM1)    05034 Alcoholism     738819 (CALM1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     738819 (CALM1)    05418 Fluid shear stress and atherosclerosis     738819 (CALM1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptr01009]     738819 (CALM1)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptr04131]     738819 (CALM1)    03036 Chromosome and associated proteins [BR:ptr03036]     738819 (CALM1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     738819 (CALM1) Protein phosphatases and associated proteins [BR:ptr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      738819 (CALM1) Membrane trafficking [BR:ptr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     738819 (CALM1) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      738819 (CALM1) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    738819 (CALM1) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N EFhand_Ca_insen EF-hand_EFHB_C Dockerin_1 FCaBP_EF-hand BamM_C TerB Caleosin DUF1103 DUF5580_M SPEF2_C EF-hand_STIM1 SurA_N_3 PA_Ig-like MecA_N Motif Other DBs NCBI-GeneID:  738819 NCBI-ProteinID:  NP_001104289 Ensembl:  ENSPTRG00000006626 VGNC:  57247 UniProt:  A5A6K5 LinkDB All DBs Position 15:88402359..88413585 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTEELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgatcagctgaccgaagaacagattgctgaattcaaggaagccttctccctattt gataaagatggcgatggcaccatcacaacaaaggaacttggaactgtcatgaggtcactg ggtcagaacccaacagaagctgaattgcaggatatgatcaatgaagtggatgctgatggt aatggcaccattgacttccccgaatttttgactatgatggctagaaaaatgaaagataca gatagtgaagaagaaatccgtgaggcattccgagtctttgacaaggatggcaatggttat atcagtgcagcagaactacgtcacgtcatgacaaacttaggagaaaaactaacagatgaa gaagtagatgaaatgatcagagaagcagatattgatggagacggacaagtcaactatgaa gaattcgtacagatgatgactgcaaaatga

DBGET integrated database retrieval system