Pan troglodytes (chimpanzee): 739817 Help Entry 739817            CDS       T01005                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     739817 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     739817 (NPS) Cytokines and neuropeptides [BR:ptr04052]  Neuropeptides   GPCR binding    739817 (NPS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  739817 NCBI-ProteinID:  XP_001141427 Ensembl:  ENSPTRG00000033882 VGNC:  4967 UniProt:  H2RB75 A0A6D2VZN0 LinkDB All DBs Position 8:139705504..139709738 Genome browser AA seq 89 aa AA seqDB search MISSLKLNLILVLSLSTMHVFWCFPVPSSKVSGKSDYFLILLNSYPTRLDRSKELAFLKP ILEKMFVKRSFRNGVGTGMKKTSFRRAKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgattagctcattaaaactcaatctcatcctagttctgtcgctgtccacaatgcatgtg ttttggtgttttccagttccgtcttctaaggtgtctggaaaatctgattactttctcatt ctgctgaacagctacccaaccagattggacaggagcaaagaactagcttttctaaagcca attttggagaagatgtttgtgaaaaggtcctttcgcaatggagttggcacagggatgaaa aaaacttcctttcgaagagcaaaatcatga

DBGET integrated database retrieval system