Pan troglodytes (chimpanzee): 740477 Help Entry 740477            CDS       T01005                                  Symbol PF4 Name (RefSeq) platelet factor 4   KO K05407   platelet factor 4 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     740477 (PF4)    04061 Viral protein interaction with cytokine and cytokine receptor     740477 (PF4)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     740477 (PF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     740477 (PF4)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     740477 (PF4) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    740477 (PF4) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Chemokines    740477 (PF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  740477 NCBI-ProteinID:  XP_001155980 Ensembl:  ENSPTRG00000016158 VGNC:  658 UniProt:  H2QPN6 A0A6D2WRB5 LinkDB All DBs Position 3:56124484..56125447 Genome browser AA seq 101 aa AA seqDB search MSSAAGFCASRPGLLFLGLLFLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLNLQAPLYKKIIKKLLES NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagctccgcagccgggttctgcgcctcacgccccgggctgctgttcctggggttgctg ttcctgccacttgtggtcgccttcgccagcgctgaagctgaagaagatggggacctgcag tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatgggagg aaaatttgcttgaacctgcaagccccgctgtacaagaaaataattaagaaacttttggag agttag

DBGET integrated database retrieval system