Pan troglodytes (chimpanzee): 741887 Help Entry 741887            CDS       T01005                                  Symbol GSTA5 Name (RefSeq) glutathione S-transferase A5   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr00480   Glutathione metabolism ptr00980   Metabolism of xenobiotics by cytochrome P450 ptr00982   Drug metabolism - cytochrome P450 ptr00983   Drug metabolism - other enzymes ptr01100   Metabolic pathways ptr01524   Platinum drug resistance ptr05200   Pathways in cancer ptr05204   Chemical carcinogenesis - DNA adducts ptr05207   Chemical carcinogenesis - receptor activation ptr05208   Chemical carcinogenesis - reactive oxygen species ptr05225   Hepatocellular carcinoma ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     741887 (GSTA5)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     741887 (GSTA5)    00982 Drug metabolism - cytochrome P450     741887 (GSTA5)    00983 Drug metabolism - other enzymes     741887 (GSTA5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     741887 (GSTA5)    05204 Chemical carcinogenesis - DNA adducts     741887 (GSTA5)    05207 Chemical carcinogenesis - receptor activation     741887 (GSTA5)    05208 Chemical carcinogenesis - reactive oxygen species     741887 (GSTA5)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     741887 (GSTA5)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     741887 (GSTA5)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     741887 (GSTA5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ptr02000]     741887 (GSTA5) Enzymes [BR:ptr01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      741887 (GSTA5) Transporters [BR:ptr02000]  Other transporters   Pores ion channels [TC:1]    741887 (GSTA5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  741887 NCBI-ProteinID:  XP_009449729 Ensembl:  ENSPTRG00000018284 VGNC:  11092 UniProt:  A0A6D2W9H0 A0A2J8P135 LinkDB All DBs Position 5:complement(58682690..58697087) Genome browser AA seq 222 aa AA seqDB search MAEKPKLHYSNARGRMESIRWLLAAAGVEFEEKFLESAEDLDKLRNDGSLLFQQVPMVEI DGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMIVLLLVCQPEERDAK TTLVKEKIKNRYFPAFEKVLKSQGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL LKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcagagaagcccaagctccactactccaatgcacggggcagaatggagtccatccgg tggctcctggctgcagctggagtagagtttgaagagaaatttctagaatctgcagaagat ttggacaagttaagaaatgatgggagtttgctgttccagcaagtaccaatggttgagatt gacgggatgaagctggtgcagaccagagccattcttaactacattgccagcaaatacaac ctttatgggaaagacatgaaggagagagccctgattgatatgtacacagaaggtatagta gatttgactgaaatgatcgttcttctgctcgtatgtcaaccagaggaaagagatgccaag accaccttggtcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta aagagccagggacaagactaccttgttggcaacaagctgagccgggctgacattcacctg gtggaacttctctactacgtggaagagcttgactcgagtcttatctccagcttccctctg ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctgcagcct ggcagccagagaaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc aggttttaa

DBGET integrated database retrieval system