Pan troglodytes (chimpanzee): 742651 Help Entry 742651            CDS       T01005                                  Name (RefSeq) interferon alpha-1/13   KO K05414   interferon alpha Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04151   PI3K-Akt signaling pathway ptr04217   Necroptosis ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04622   RIG-I-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr04630   JAK-STAT signaling pathway ptr04650   Natural killer cell mediated cytotoxicity ptr04936   Alcoholic liver disease ptr05152   Tuberculosis ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05165   Human papillomavirus infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05168   Herpes simplex virus 1 infection ptr05169   Epstein-Barr virus infection ptr05170   Human immunodeficiency virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05200   Pathways in cancer ptr05320   Autoimmune thyroid disease ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     742651    04151 PI3K-Akt signaling pathway     742651   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     742651  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     742651  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     742651    04621 NOD-like receptor signaling pathway     742651    04622 RIG-I-like receptor signaling pathway     742651    04623 Cytosolic DNA-sensing pathway     742651    04650 Natural killer cell mediated cytotoxicity     742651  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     742651   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     742651    05161 Hepatitis B     742651    05160 Hepatitis C     742651    05171 Coronavirus disease - COVID-19     742651    05164 Influenza A     742651    05162 Measles     742651    05168 Herpes simplex virus 1 infection     742651    05163 Human cytomegalovirus infection     742651    05167 Kaposi sarcoma-associated herpesvirus infection     742651    05169 Epstein-Barr virus infection     742651    05165 Human papillomavirus infection     742651   09171 Infectious disease: bacterial    05152 Tuberculosis     742651   09163 Immune disease    05320 Autoimmune thyroid disease     742651   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     742651   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     742651  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     742651 Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interferons    742651 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Motif Other DBs NCBI-GeneID:  742651 NCBI-ProteinID:  XP_001152509 UniProt:  A0A7R8C398 LinkDB All DBs Position 11:complement(94452914..94454002) Genome browser AA seq 239 aa AA seqDB search MESGPEALRKWKSVCSLFKAFAGSKAFREPRAQGSESPISASPEASAVSTMASPFALLMA LVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAKMSRISPSSCLMDRHDFGFPQEEFDGNQ FQKAPAISVLHELIQQIFNLFTTKDSSAAWDEELLDKFCTELYQQLNDLEACVMQEERVG ETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggaaagtggcccagaagcattaagaaagtggaaatcagtatgttccctatttaaggca tttgcaggaagcaaggccttcagagaacctagagcccaaggttcagagtcacccatctca gcaagcccagaagcatctgcagtatctacgatggcctcaccctttgctttactgatggcc ctggtggtgctcagctgcaagtcaagctgctctctgggctgtgatctccctgagacccac agcctggataacaggaggaccttgatgctcctggcaaaaatgagcagaatctctccttcc tcctgtctgatggacagacatgactttggatttccccaggaggagtttgatggcaaccag ttccagaaggctccagccatctctgtcctccatgagctgatccagcagatcttcaacctc tttaccacaaaagattcatctgctgcttgggatgaggaactcctagacaaattctgcact gaactctaccagcagctgaatgacttggaagcctgtgtgatgcaggaggagagggtggga gaaactcccctgatgaatgcggactccatcttggctgtgaagaaatacttccgaagaatc actctctatctgacagagaagaaatacagcccttgtgcctgggaggttgtcagagcagaa atcatgagatccctctctttatcaacaaacttgcaagaaagattaaggaggaaggaataa

DBGET integrated database retrieval system