Pan troglodytes (chimpanzee): 742713 Help Entry 742713            CDS       T01005                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr01521   EGFR tyrosine kinase inhibitor resistance ptr01522   Endocrine resistance ptr04010   MAPK signaling pathway ptr04012   ErbB signaling pathway ptr04014   Ras signaling pathway ptr04015   Rap1 signaling pathway ptr04062   Chemokine signaling pathway ptr04068   FoxO signaling pathway ptr04071   Sphingolipid signaling pathway ptr04072   Phospholipase D signaling pathway ptr04137   Mitophagy - animal ptr04140   Autophagy - animal ptr04150   mTOR signaling pathway ptr04151   PI3K-Akt signaling pathway ptr04210   Apoptosis ptr04211   Longevity regulating pathway ptr04213   Longevity regulating pathway - multiple species ptr04218   Cellular senescence ptr04360   Axon guidance ptr04370   VEGF signaling pathway ptr04371   Apelin signaling pathway ptr04540   Gap junction ptr04550   Signaling pathways regulating pluripotency of stem cells ptr04625   C-type lectin receptor signaling pathway ptr04650   Natural killer cell mediated cytotoxicity ptr04660   T cell receptor signaling pathway ptr04662   B cell receptor signaling pathway ptr04664   Fc epsilon RI signaling pathway ptr04714   Thermogenesis ptr04720   Long-term potentiation ptr04722   Neurotrophin signaling pathway ptr04725   Cholinergic synapse ptr04726   Serotonergic synapse ptr04730   Long-term depression ptr04810   Regulation of actin cytoskeleton ptr04910   Insulin signaling pathway ptr04912   GnRH signaling pathway ptr04915   Estrogen signaling pathway ptr04916   Melanogenesis ptr04917   Prolactin signaling pathway ptr04919   Thyroid hormone signaling pathway ptr04921   Oxytocin signaling pathway ptr04926   Relaxin signaling pathway ptr04929   GnRH secretion ptr04933   AGE-RAGE signaling pathway in diabetic complications ptr04935   Growth hormone synthesis, secretion and action ptr05010   Alzheimer disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05034   Alcoholism ptr05160   Hepatitis C ptr05161   Hepatitis B ptr05163   Human cytomegalovirus infection ptr05165   Human papillomavirus infection ptr05166   Human T-cell leukemia virus 1 infection ptr05167   Kaposi sarcoma-associated herpesvirus infection ptr05170   Human immunodeficiency virus 1 infection ptr05200   Pathways in cancer ptr05203   Viral carcinogenesis ptr05205   Proteoglycans in cancer ptr05206   MicroRNAs in cancer ptr05207   Chemical carcinogenesis - receptor activation ptr05208   Chemical carcinogenesis - reactive oxygen species ptr05210   Colorectal cancer ptr05211   Renal cell carcinoma ptr05213   Endometrial cancer ptr05214   Glioma ptr05215   Prostate cancer ptr05216   Thyroid cancer ptr05218   Melanoma ptr05219   Bladder cancer ptr05220   Chronic myeloid leukemia ptr05221   Acute myeloid leukemia ptr05223   Non-small cell lung cancer ptr05224   Breast cancer ptr05225   Hepatocellular carcinoma ptr05226   Gastric cancer ptr05230   Central carbon metabolism in cancer ptr05231   Choline metabolism in cancer ptr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     742713 (NRAS)    04012 ErbB signaling pathway     742713 (NRAS)    04014 Ras signaling pathway     742713 (NRAS)    04015 Rap1 signaling pathway     742713 (NRAS)    04370 VEGF signaling pathway     742713 (NRAS)    04371 Apelin signaling pathway     742713 (NRAS)    04068 FoxO signaling pathway     742713 (NRAS)    04072 Phospholipase D signaling pathway     742713 (NRAS)    04071 Sphingolipid signaling pathway     742713 (NRAS)    04151 PI3K-Akt signaling pathway     742713 (NRAS)    04150 mTOR signaling pathway     742713 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     742713 (NRAS)    04137 Mitophagy - animal     742713 (NRAS)   09143 Cell growth and death    04210 Apoptosis     742713 (NRAS)    04218 Cellular senescence     742713 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     742713 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     742713 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     742713 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     742713 (NRAS)    04650 Natural killer cell mediated cytotoxicity     742713 (NRAS)    04660 T cell receptor signaling pathway     742713 (NRAS)    04662 B cell receptor signaling pathway     742713 (NRAS)    04664 Fc epsilon RI signaling pathway     742713 (NRAS)    04062 Chemokine signaling pathway     742713 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     742713 (NRAS)    04929 GnRH secretion     742713 (NRAS)    04912 GnRH signaling pathway     742713 (NRAS)    04915 Estrogen signaling pathway     742713 (NRAS)    04917 Prolactin signaling pathway     742713 (NRAS)    04921 Oxytocin signaling pathway     742713 (NRAS)    04926 Relaxin signaling pathway     742713 (NRAS)    04935 Growth hormone synthesis, secretion and action     742713 (NRAS)    04919 Thyroid hormone signaling pathway     742713 (NRAS)    04916 Melanogenesis     742713 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     742713 (NRAS)    04726 Serotonergic synapse     742713 (NRAS)    04720 Long-term potentiation     742713 (NRAS)    04730 Long-term depression     742713 (NRAS)    04722 Neurotrophin signaling pathway     742713 (NRAS)   09158 Development and regeneration    04360 Axon guidance     742713 (NRAS)   09149 Aging    04211 Longevity regulating pathway     742713 (NRAS)    04213 Longevity regulating pathway - multiple species     742713 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     742713 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     742713 (NRAS)    05206 MicroRNAs in cancer     742713 (NRAS)    05205 Proteoglycans in cancer     742713 (NRAS)    05207 Chemical carcinogenesis - receptor activation     742713 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     742713 (NRAS)    05203 Viral carcinogenesis     742713 (NRAS)    05230 Central carbon metabolism in cancer     742713 (NRAS)    05231 Choline metabolism in cancer     742713 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     742713 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     742713 (NRAS)    05225 Hepatocellular carcinoma     742713 (NRAS)    05226 Gastric cancer     742713 (NRAS)    05214 Glioma     742713 (NRAS)    05216 Thyroid cancer     742713 (NRAS)    05221 Acute myeloid leukemia     742713 (NRAS)    05220 Chronic myeloid leukemia     742713 (NRAS)    05218 Melanoma     742713 (NRAS)    05211 Renal cell carcinoma     742713 (NRAS)    05219 Bladder cancer     742713 (NRAS)    05215 Prostate cancer     742713 (NRAS)    05213 Endometrial cancer     742713 (NRAS)    05224 Breast cancer     742713 (NRAS)    05223 Non-small cell lung cancer     742713 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     742713 (NRAS)    05170 Human immunodeficiency virus 1 infection     742713 (NRAS)    05161 Hepatitis B     742713 (NRAS)    05160 Hepatitis C     742713 (NRAS)    05163 Human cytomegalovirus infection     742713 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     742713 (NRAS)    05165 Human papillomavirus infection     742713 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     742713 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     742713 (NRAS)   09165 Substance dependence    05034 Alcoholism     742713 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     742713 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     742713 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     742713 (NRAS)    01522 Endocrine resistance     742713 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptr04131]     742713 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     742713 (NRAS)    04031 GTP-binding proteins [BR:ptr04031]     742713 (NRAS) Membrane trafficking [BR:ptr04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     742713 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     742713 (NRAS) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    742713 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    742713 (NRAS)   Exosomal proteins of breast cancer cells    742713 (NRAS)   Exosomal proteins of colorectal cancer cells    742713 (NRAS) GTP-binding proteins [BR:ptr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     742713 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  742713 NCBI-ProteinID:  XP_001149822 Ensembl:  ENSPTRG00000001140 VGNC:  10029 UniProt:  H2PZQ7 A0A6D2WNU3 LinkDB All DBs Position 1:complement(111935790..111948107) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac agaaaacaagtggttatagatggtgaaacctgtttgttggacatactggatacagctgga caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcagatattaacctctacagggagcagatt aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system