Pan troglodytes (chimpanzee): 745935 Help Entry 745935            CDS       T01005                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04620   Toll-like receptor signaling pathway ptr05142   Chagas disease ptr05163   Human cytomegalovirus infection ptr05323   Rheumatoid arthritis ptr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     745935    04061 Viral protein interaction with cytokine and cytokine receptor     745935  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     745935    04062 Chemokine signaling pathway     745935  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     745935   09174 Infectious disease: parasitic    05142 Chagas disease     745935   09163 Immune disease    05323 Rheumatoid arthritis     745935   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     745935  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     745935    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     745935 Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    745935 Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Chemokines    745935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  745935 NCBI-ProteinID:  XP_001152451 LinkDB All DBs Position 19:complement(29915614..29918071) Genome browser AA seq 99 aa AA seqDB search MQVSTAALAVLLCTMALCTTCDSCLFSPFSAVAADTPTACCFSYISRQIPQNFIADYFET SSQCSKPGVIFLTKRGRQVCADPSEEWVQKYVSDLELSA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcaggtctccactgctgcccttgccgtcctgctctgcaccatggctctctgcaccacc tgtgactcgtgcttattctctcctttctctgcagttgctgctgacacgccgaccgcctgc tgcttcagctatatctcccgacagattccacagaatttcatagcggactactttgagacc agcagccagtgctccaagcccggtgtcatcttcctaaccaagagaggccggcaggtctgt gctgaccccagtgaggagtgggtccagaaatacgtcagtgacctggagctaagtgcctga

DBGET integrated database retrieval system