Pan troglodytes (chimpanzee): 746075 Help Entry 746075            CDS       T01005                                  Symbol CSTA Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism ptr  Pan troglodytes (chimpanzee) Brite KEGG Orthology (KO) [BR:ptr00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ptr01002]     746075 (CSTA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     746075 (CSTA) Peptidases and inhibitors [BR:ptr01002]  Peptidase inhibitors   Family I25: cystatin family    746075 (CSTA) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    746075 (CSTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Afaf DUF8076 Motif Other DBs NCBI-GeneID:  746075 NCBI-ProteinID:  XP_001166441 Ensembl:  ENSPTRG00000015290 VGNC:  6196 UniProt:  H2QN77 A0A6D2Y6R7 LinkDB All DBs Position 2:125600541..125617281 Genome browser AA seq 98 aa AA seqDB search MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAG DNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatacctggaggcttatctgaggccaaacccgccactccagaaatccaggagattgtt gataaggttaaaccacagcttgaagaaaaaacaaatgagacttacggaaaattggaagct gtgcagtataaaactcaagttgttgctggaacaaattactacattaaggtacgagcaggt gataataaatatatgcacttgaaagtattcaaaagtcttcccggacaaaatgaggacttg gtacttactggataccaggttgacaaaaacaaggacgacgagctgacgggcttttag

DBGET integrated database retrieval system