KEGG   Pan troglodytes (chimpanzee): 746245
Entry
746245            CDS       T01005                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04927  Cortisol synthesis and secretion
ptr04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    746245 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    746245 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 746245
NCBI-ProteinID: NP_001065291
VGNC: 14676
UniProt: Q68UT4
LinkDB
Position
21:18863809..18885084
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSGSPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPD
QPLRQESSSTLPLGVFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtggacgagaagaagctgaaagcccacaaacattccatcgtgatc
gcattctgggtgagcctggctgccttcgtggtgctgctcttcctcatcttgctctacatg
tcctggtccggctccccgcagatgaggaacagccccaagcaccaccaaacatgcccctgg
agtcacggcctcaacctccacctctgcattcagaagtgcctgccgtgccacagggaaccc
ctggcaacctcacaggctcaggcgagctcagtggagccagggagcagaactggccctgac
cagccgctacgacaggagagctcctccaccttgcccctcggggttttccagacccatccc
actctcctctgggaattgaccctcaatgggggtcccctcgtcaggagcaagcccagcgag
cctccccctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system