Pan troglodytes (chimpanzee): 746457 Help Entry 746457            CDS       T01005                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04014   Ras signaling pathway ptr04137   Mitophagy - animal ptr04144   Endocytosis ptr04145   Phagosome ptr04148   Efferocytosis ptr04962   Vasopressin-regulated water reabsorption ptr05132   Salmonella infection ptr05146   Amoebiasis ptr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     746457 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     746457 (RAB5B)    04145 Phagosome     746457 (RAB5B)    04137 Mitophagy - animal     746457 (RAB5B)    04148 Efferocytosis     746457 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     746457 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     746457 (RAB5B)    05152 Tuberculosis     746457 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     746457 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptr04131]     746457 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     746457 (RAB5B)    04031 GTP-binding proteins [BR:ptr04031]     746457 (RAB5B) Membrane trafficking [BR:ptr04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     746457 (RAB5B)  Endosome - Lysosome transport     746457 (RAB5B) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    746457 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    746457 (RAB5B)   Exosomal proteins of colorectal cancer cells    746457 (RAB5B)   Exosomal proteins of melanoma cells    746457 (RAB5B) GTP-binding proteins [BR:ptr04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     746457 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  746457 NCBI-ProteinID:  XP_063642707 Ensembl:  ENSPTRG00000005071 VGNC:  10512 UniProt:  K7D6I0 LinkDB All DBs Position 10:complement(40018286..40039451) Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag ttcaaattggtcctgctgggagaatctgcagtgggaaagtcaagcctggtattacgtttt gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag tccgtttgtctagatgacacaacagtgaagtttgagatctgggacacagctgggcaggag cgatatcacagcttagcccccatgtactacaggggtgcccaagctgcaatcgtggtttac gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaggaactacagcga caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaacaaa cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg gagacttcagccaagacggctatgaacgtgaatgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctgggaggtgcagcaggccgaagccggggtgtggat ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system