Pan troglodytes (chimpanzee): 746468 Help Entry 746468            CDS       T01005                                  Symbol H2AC18 Name (RefSeq) histone H2A type 2-A   KO K11251   histone H2A Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03082   ATP-dependent chromatin remodeling ptr04217   Necroptosis ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     746468 (H2AC18)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     746468 (H2AC18)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     746468 (H2AC18)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     746468 (H2AC18)   09165 Substance dependence    05034 Alcoholism     746468 (H2AC18)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     746468 (H2AC18)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     746468 (H2AC18) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     746468 (H2AC18) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    746468 (H2AC18) SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Histone_ABTB Clp_N Motif Other DBs NCBI-GeneID:  746468 NCBI-ProteinID:  XP_003949577 VGNC:  83676 UniProt:  A0A2I3RS50 A0A5S6RBC9 LinkDB All DBs Position 1:99380295..99380805 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcgctcgtcc cgcgctggccttcagttcccggtagggcgagtgcatcgcttgctgcgcaaaggcaactat gcggagcgagtgggggccggcgcgcccgtctacatggctgcggtcctcgagtatctgacc gccgagatcctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc cctcgtcacctccagctggccatccgcaacgacgaggaactgaacaagctgctgggcaaa gtcaccatcgcccagggcggcgtcttgcctaacatccaggccgtactgctccctaagaag acggagagtcaccacaaggcaaagggcaagtga

DBGET integrated database retrieval system