Pan troglodytes (chimpanzee): 746513 Help Entry 746513            CDS       T01005                                  Symbol H2BC21 Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05203   Viral carcinogenesis ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     746513 (H2BC21)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     746513 (H2BC21)   09163 Immune disease    05322 Systemic lupus erythematosus     746513 (H2BC21)   09165 Substance dependence    05034 Alcoholism     746513 (H2BC21)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     746513 (H2BC21)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     746513 (H2BC21) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     746513 (H2BC21) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    746513 (H2BC21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  746513 NCBI-ProteinID:  XP_003308405 Ensembl:  ENSPTRG00000050454 VGNC:  83680 UniProt:  H2R8P6 A0A5S6R6Z4 LinkDB All DBs Position 1:99336503..99338684 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggcaaaatccgctccggcccctaaaaaaggctctaagaaagccgtcacc aaagcccagaagaaagacggcaagaagcgcaagcgcagccggaaagagagctactccatc tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggagaggcttcccgc ctggcgcactacaacaagcgctccaccatcacatcccgcgagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system