Pan troglodytes (chimpanzee): 747727 Help Entry 747727            CDS       T01005                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04010   MAPK signaling pathway ptr04014   Ras signaling pathway ptr04015   Rap1 signaling pathway ptr04020   Calcium signaling pathway ptr04151   PI3K-Akt signaling pathway ptr04810   Regulation of actin cytoskeleton ptr05200   Pathways in cancer ptr05207   Chemical carcinogenesis - receptor activation ptr05218   Melanoma ptr05224   Breast cancer ptr05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     747727 (FGF4)    04014 Ras signaling pathway     747727 (FGF4)    04015 Rap1 signaling pathway     747727 (FGF4)    04020 Calcium signaling pathway     747727 (FGF4)    04151 PI3K-Akt signaling pathway     747727 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     747727 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     747727 (FGF4)    05207 Chemical carcinogenesis - receptor activation     747727 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     747727 (FGF4)    05218 Melanoma     747727 (FGF4)    05224 Breast cancer     747727 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     747727 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     747727 (FGF4) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Growth factors (RTK binding)    747727 (FGF4) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Growth factors/receptors    747727 (FGF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  747727 NCBI-ProteinID:  XP_001173970 Ensembl:  ENSPTRG00000004000 VGNC:  11356 UniProt:  H2Q4B4 A0A6D2W8I2 LinkDB All DBs Position 9:complement(71827507..71831827) Genome browser AA seq 206 aa AA seqDB search MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVARSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECKFKEILLPNNYNAYESYKYPGMFIA LSKNGKTKKGNRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atgtcggggcccgggacggccgcggtagcgctgctcccggcggtcctgctggccttgctg gcgccctgggcgggccgagggggcgccgccgcacccactgcacccaacggcacgctggag gccgagctggagcgccgctgggagagcctggtggcgcgctcgttggcgcgcctgccggtg gcagcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggctctcccc gacggccgcatcggcggcgcgcacgcggacacccgcgacagcctgctggagctctcgccc gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc agcaagggcaagctctatggctcgcccttcttcaccgatgagtgcaagttcaaggagatt ctccttcccaacaactacaacgcctacgagtcctacaagtaccccggcatgttcatcgcc ctgagcaagaatgggaagaccaagaaggggaaccgagtgtcgcccaccatgaaggtcacc cacttcctccccaggctgtga

DBGET integrated database retrieval system