Pan troglodytes (chimpanzee): 748205 Help Entry 748205            CDS       T01005                                  Symbol CCL2 Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04061   Viral protein interaction with cytokine and cytokine receptor ptr04062   Chemokine signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04657   IL-17 signaling pathway ptr04668   TNF signaling pathway ptr04933   AGE-RAGE signaling pathway in diabetic complications ptr05135   Yersinia infection ptr05142   Chagas disease ptr05144   Malaria ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05168   Herpes simplex virus 1 infection ptr05171   Coronavirus disease ptr05323   Rheumatoid arthritis ptr05417   Lipid and atherosclerosis ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     748205 (CCL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     748205 (CCL2)    04061 Viral protein interaction with cytokine and cytokine receptor     748205 (CCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     748205 (CCL2)    04657 IL-17 signaling pathway     748205 (CCL2)    04062 Chemokine signaling pathway     748205 (CCL2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     748205 (CCL2)    05164 Influenza A     748205 (CCL2)    05168 Herpes simplex virus 1 infection     748205 (CCL2)    05163 Human cytomegalovirus infection     748205 (CCL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     748205 (CCL2)   09174 Infectious disease: parasitic    05144 Malaria     748205 (CCL2)    05142 Chagas disease     748205 (CCL2)   09163 Immune disease    05323 Rheumatoid arthritis     748205 (CCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     748205 (CCL2)    05418 Fluid shear stress and atherosclerosis     748205 (CCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     748205 (CCL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     748205 (CCL2)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     748205 (CCL2) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Chemokines    748205 (CCL2) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Chemokines    748205 (CCL2) SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  748205 NCBI-ProteinID:  XP_001174551 Ensembl:  ENSPTRG00000008999 VGNC:  9167 UniProt:  K7D2S5 H2QCN3 LinkDB All DBs Position 19:complement(33345818..33347761) Genome browser AA seq 99 aa AA seqDB search MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctctgccgcgcttctgtgcctgctgctcatagcagccaccttcattccccag gggctcgctcagccagatgcaatcaatgccccagtcacctgctgctataacttcaccaat aggaagatctcagtgcagaggctggcgagctatagaagaatcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga

DBGET integrated database retrieval system