Pan troglodytes (chimpanzee): 750383 Help Entry 750383            CDS       T01005                                  Symbol MYL5 Name (RefSeq) myosin light chain 5 isoform X2   KO K12753   myosin regulatory light chain 5 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04360   Axon guidance ptr04510   Focal adhesion ptr04520   Adherens junction ptr04670   Leukocyte transendothelial migration ptr04810   Regulation of actin cytoskeleton ptr04814   Motor proteins ptr04820   Cytoskeleton in muscle cells ptr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptr00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     750383 (MYL5)    04520 Adherens junction     750383 (MYL5)   09142 Cell motility    04814 Motor proteins     750383 (MYL5)    04820 Cytoskeleton in muscle cells     750383 (MYL5)    04810 Regulation of actin cytoskeleton     750383 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     750383 (MYL5)   09158 Development and regeneration    04360 Axon guidance     750383 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     750383 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ptr04812]     750383 (MYL5) Cytoskeleton proteins [BR:ptr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      750383 (MYL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 DUF945 EF-hand_4 Motif Other DBs NCBI-GeneID:  750383 NCBI-ProteinID:  XP_016806594 Ensembl:  ENSPTRG00000033963 VGNC:  48920 UniProt:  A0A2J8K730 LinkDB All DBs Position 4:complement(3274841..3283048) Genome browser AA seq 132 aa AA seqDB search MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDA EETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDAAGNLDYKAL SYVITHGEEKEE NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctatgcctcc ctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctcgggg cccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgacgcc gaggaaaccattcttaacgccttcaagatgctggacccggacgggaaagggaaaatcaac aaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggaagaggtg gaccagatgttccagttcgcctccatcgatgcggcgggcaacctggactacaaggcgctc agctacgtgatcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system