Panthera uncia (snow leopard): 125908721 Help Entry 125908721         CDS       T08832                                  Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism puc  Panthera uncia (snow leopard) Pathway puc03083   Polycomb repressive complex puc04010   MAPK signaling pathway puc05200   Pathways in cancer puc05202   Transcriptional misregulation in cancer puc05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:puc00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     125908721  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125908721  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125908721    05202 Transcriptional misregulation in cancer     125908721   09162 Cancer: specific types    05222 Small cell lung cancer     125908721  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:puc03000]     125908721    03036 Chromosome and associated proteins [BR:puc03036]     125908721 Transcription factors [BR:puc03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     125908721 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      125908721 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  125908721 NCBI-ProteinID:  XP_049467448 LinkDB All DBs Position B3 Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataacgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatatcgatgacctcaagcggcagaatgctctcctggagcagcaagtccgt gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatggaggctcagactcc agctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system