Panthera uncia (snow leopard): 125909334 Help Entry 125909334         CDS       T08832                                  Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism puc  Panthera uncia (snow leopard) Pathway puc01522   Endocrine resistance puc04010   MAPK signaling pathway puc04024   cAMP signaling pathway puc04210   Apoptosis puc04380   Osteoclast differentiation puc04620   Toll-like receptor signaling pathway puc04657   IL-17 signaling pathway puc04658   Th1 and Th2 cell differentiation puc04659   Th17 cell differentiation puc04660   T cell receptor signaling pathway puc04662   B cell receptor signaling pathway puc04668   TNF signaling pathway puc04713   Circadian entrainment puc04725   Cholinergic synapse puc04728   Dopaminergic synapse puc04915   Estrogen signaling pathway puc04917   Prolactin signaling pathway puc04921   Oxytocin signaling pathway puc04926   Relaxin signaling pathway puc04928   Parathyroid hormone synthesis, secretion and action puc04932   Non-alcoholic fatty liver disease puc04935   Growth hormone synthesis, secretion and action puc05031   Amphetamine addiction puc05132   Salmonella infection puc05133   Pertussis puc05135   Yersinia infection puc05140   Leishmaniasis puc05142   Chagas disease puc05161   Hepatitis B puc05162   Measles puc05166   Human T-cell leukemia virus 1 infection puc05167   Kaposi sarcoma-associated herpesvirus infection puc05170   Human immunodeficiency virus 1 infection puc05171   Coronavirus disease - COVID-19 puc05200   Pathways in cancer puc05207   Chemical carcinogenesis - receptor activation puc05208   Chemical carcinogenesis - reactive oxygen species puc05210   Colorectal cancer puc05224   Breast cancer puc05231   Choline metabolism in cancer puc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer puc05323   Rheumatoid arthritis puc05417   Lipid and atherosclerosis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125909334    04668 TNF signaling pathway     125909334    04024 cAMP signaling pathway     125909334  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     125909334  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125909334    04660 T cell receptor signaling pathway     125909334    04658 Th1 and Th2 cell differentiation     125909334    04659 Th17 cell differentiation     125909334    04657 IL-17 signaling pathway     125909334    04662 B cell receptor signaling pathway     125909334   09152 Endocrine system    04915 Estrogen signaling pathway     125909334    04917 Prolactin signaling pathway     125909334    04921 Oxytocin signaling pathway     125909334    04926 Relaxin signaling pathway     125909334    04935 Growth hormone synthesis, secretion and action     125909334    04928 Parathyroid hormone synthesis, secretion and action     125909334   09156 Nervous system    04725 Cholinergic synapse     125909334    04728 Dopaminergic synapse     125909334   09158 Development and regeneration    04380 Osteoclast differentiation     125909334   09159 Environmental adaptation    04713 Circadian entrainment     125909334  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125909334    05207 Chemical carcinogenesis - receptor activation     125909334    05208 Chemical carcinogenesis - reactive oxygen species     125909334    05231 Choline metabolism in cancer     125909334    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125909334   09162 Cancer: specific types    05210 Colorectal cancer     125909334    05224 Breast cancer     125909334   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125909334    05170 Human immunodeficiency virus 1 infection     125909334    05161 Hepatitis B     125909334    05171 Coronavirus disease - COVID-19     125909334    05162 Measles     125909334    05167 Kaposi sarcoma-associated herpesvirus infection     125909334   09171 Infectious disease: bacterial    05132 Salmonella infection     125909334    05135 Yersinia infection     125909334    05133 Pertussis     125909334   09174 Infectious disease: parasitic    05140 Leishmaniasis     125909334    05142 Chagas disease     125909334   09163 Immune disease    05323 Rheumatoid arthritis     125909334   09165 Substance dependence    05031 Amphetamine addiction     125909334   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125909334    05418 Fluid shear stress and atherosclerosis     125909334   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     125909334   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     125909334  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:puc03000]     125909334    04131 Membrane trafficking [BR:puc04131]     125909334 Transcription factors [BR:puc03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     125909334 Membrane trafficking [BR:puc04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     125909334 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  125909334 NCBI-ProteinID:  XP_049468414 LinkDB All DBs Position B3 Genome browser AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcctgtcaatgcgcaggacttctgcacggatctggctgtctccagcgccaacttt atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggctccttctcagaccagagccccccacccctatggagtccccgcc ccctccgccggggcttactccagggctggagtcgtgaagactgtgaccgcaggaggccga gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg gagctcacggatacgctgcaagcggagacagaccaactagaagatgagaagtctgctttg cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct caccgacccgcctgcaagatccccgatgacctgggcttcccggaagagatgtctgtggct tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc accctgcccctcctcaatgatcctgagcccaagccctccgtggagccggtcaagagcatc agcagcatggagctgaaggccgagccctttgatgacttcctgttcccagcatcgtccagg cccagcggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system