Panthera uncia (snow leopard): 125913108 Help Entry 125913108         CDS       T08832                                  Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism puc  Panthera uncia (snow leopard) Pathway puc04022   cGMP-PKG signaling pathway puc04024   cAMP signaling pathway puc04066   HIF-1 signaling pathway puc04081   Hormone signaling puc04270   Vascular smooth muscle contraction puc04714   Thermogenesis puc04921   Oxytocin signaling pathway puc04923   Regulation of lipolysis in adipocytes puc04924   Renin secretion puc04925   Aldosterone synthesis and secretion puc05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     125913108    04024 cAMP signaling pathway     125913108    04022 cGMP-PKG signaling pathway     125913108   09133 Signaling molecules and interaction    04081 Hormone signaling     125913108  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     125913108    04921 Oxytocin signaling pathway     125913108    04924 Renin secretion     125913108    04925 Aldosterone synthesis and secretion     125913108   09153 Circulatory system    04270 Vascular smooth muscle contraction     125913108   09159 Environmental adaptation    04714 Thermogenesis     125913108  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     125913108  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125913108 Cytokines and neuropeptides [BR:puc04052]  Neuropeptides   Unclassified    125913108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  125913108 NCBI-ProteinID:  XP_049474038 LinkDB All DBs Position C1 Genome browser AA seq 153 aa AA seqDB search MGSFSTITASFLLFLACQLLWQTGANPVYGSVSNADLMDFKNLLDHLEDKMPLEDEVVPP QVLSEQNEEAGAALSPLPEVPPWAGEVNPAQRDGGALGRGSWDSSDRSALLKSKLRALLA APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggctccttctccaccatcactgcgagcttcctcctcttcctggcgtgtcagctcctg tggcaaacaggagctaacccggtatatggctctgtgtccaacgcagacctgatggatttc aagaatttgctggaccatttggaggacaagatgcctttagaagatgaagtcgtgccccca caagtactaagtgagcagaatgaggaagctggggcagctcttagccccctccctgaggtg cctccctgggctggggaggtcaacccagcccagagagatgggggtgcccttgggcggggc tcctgggactcctctgatagatctgccctcctgaaaagcaagttgagggcactgcttgct gcccctcggagtctgcggaggtccagctgctttggaggcaggatggacaggattggagct cagagtggactgggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system